USD $1.00-10.00 / Kilogram
USD $2,000.00-2,000.00 / Metric Ton
USD $1.00-10.00 / Kilogram
superiority
pioneerbiotech is a leading manufacturer and supplier of chemicals in china. we develop ,produce and distribute high quality pharmaceuticals, intermediates, special chemicals and other fine chemicals.
we could give you:
1.best quality in your requirement
2.competitive price in china market
3.mature technical support
4.professional logistic support
all we want is win-win business. send yr. inquiries, you will get it!
gmp and mdf certificated salmon calcitonin,cas.:47931-85-1, in bulk supply ,welcome inquiry
name | salmon calcitonin 47931-85-1 | ||||
accession number | db00017 (biod00025, btd00025) | ||||
type | biotech | ||||
groups | approved | ||||
description |
synthetic peptide, 32 residues long formulated as a nasal spray. |
||||
protein structure | |||||
protein chemical formula | c145h240n44o48s2 | ||||
protein average weight | 3431.8530 | ||||
sequences |
>db00017 sequence csnlstcvlgklsqelhklqtyprtntgsgtpfasta |
||||
synonyms |
|
||||
salts | not available | ||||
brand mixtures | not available | ||||
categories |
|
||||
cas number | 47931-85-1 thyrocalcitonin | ||||
taxonomy | |||||
---|---|---|---|---|---|
kingdom | not available | ||||
classes | not available | ||||
substructures | not available | ||||
pharmacology | |||||
indication | for the treatment of post-menopausal osteoporosis | ||||
pharmacodynamics | calcitonin inhibits bone removal by osteoclasts (bone remodeling cells) and promotes bone formation by osteoblasts. this leads to a net increase in bone mass. calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. | ||||
mechanism of action | calcitonin binds to the calcitonin receptor (found primarily in osteoclasts) which then enhances the production of vitamin d producing enzymes (25-hydroxyvitamine d-24-hydroxylase), leading to greater calcium retention and enhanced bone density. binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. | ||||
absorption | salmon calcitonin is rapidly absorbed and eliminated. bioavailability following subcutaneous and intramuscular injection in humans is high and similar for the two routes of administration (71% and 66%, respectively). | ||||
volume of distribution | not available | ||||
protein binding | 30 to 40% | ||||
metabolism | salmon calcitonin is primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. | ||||
route of elimination | studies with injectable calcitonin show increases in the excretion of filtered phosphate, calcium, and sodium by decreasing their tubular reabsorption in the kidney. | ||||
half life | 50-80 minutes | ||||
clearance | not available | ||||
toxicity | salmon calcitonin is devoid of embryotoxic, teratogenic and mutagenic potential. | ||||
affected organisms |
|
about our company
founded in 2014, as a professional international pharmaceutical corporation,
headquartered in xi'an (china), konochemco., ltd. is a leading producer of
standardized herbal extracts, natural active ingredients and apis for pharmaceutical,
health food and cosmetic industries.
bulk herbal nutrients& phytochemical manufacture, food ingredients supplier
the most favorable price best quality
please visit our website: www.konochemical.com
contact us via email: sales6@konochemical .com
telephone: 029- 88771412
fax: 029- 81330164
qq: 206474269
5. package of our products
6.extraction equipment
7. express delivery
to know more about our products, please check the catalogue at below:
products catalogue of kono chem |
|||||
no |
name |
source |
purity |
standard |
package |
001 |
coenzyme q10 |
tobacco |
10%-99% |
usp32 |
drum & bag |
002 |
l-glutathione |
yeast |
99% |
jp |
drum & bag |
003 |
ecdysterone |
cyanotis arachnoidea |
50%-98% |
cp2005 |
drum & bag |
004 |
capsaicin |
chili pepper |
10%-95% |
usp32 |
drum & bag |
005 006 |
matrine oxymatrine |
sophora flavescens sophora flavescens |
1%-98% 1%-98% |
usp32 usp32 |
drum & bag drum & bag |
007 |
raspberry ketone |
raspberry |
99% |
usp32 |
drum & bag |
008 |
oleanolic acid |
ligustrum lucidum ait. |
98% |
cp2010 |
drum & bag |
009 |
ursolic acid |
eriobotrya japonica(thunb.)lindl |
1%-98% |
cp2010 |
drum & bag |
010 |
chlorogenic acid |
eucommia ulmoides oliv. |
1%-98% |
cp2010 |
drum & bag |
011 |
usnic acid |
usneaceae |
98% |
cp2010 |
drum & bag |
012 |
shikimic acid |
illicium verum hook.f.) |
98% |
usp32 |
drum & bag |
013 |
sinomenine hcl |
sinomenium actum rehd.et |
98% |
usp32 |
drum & bag |
014 |
berberine hcl |
coptis chinensis franch |
98% |
cp2010 |
drum & bag |
015 016 |
silymarin silybinin |
milk thistle milk thistle |
80% 98% |
ep6 ep6 |
drum & bag drum & bag |
017 018 019 020 021 022 023 |
lutein zeaxanthin lycopene beta carotene canthaxanthin fucoxanthin astaxanthin |
marigold flower marigold flower tomato carrot algae brown algae haematococcus pluvialis |
2%-98% 5%-20% 1%-10% 1%-98% 1%-10% 1%-10% 1%-10% |
usp32 in house usp32 usp32 usp32 in house in house |
drum & bag drum & bag drum & bag drum & bag drum & bag drum & bag drum & bag |