Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 196109 > 

196109-31-6

Basic Information
CAS No.: 196109-31-6
Name: EXENDIN-4 (3-39)
Molecular Structure:
Molecular Structure of 196109-31-6 (EXENDIN-4 (3-39))
Formula: C176H272 N46 O58 S
Molecular Weight: 3992.38128
Synonyms: EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;EXENDIN-4 (3-39);EXENDIN (3-39);H-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
  • Display:default sort

    New supplier

  • High Quality 99% Exendin-4 (3-39) 196109-31-6 GMP Manufacturer

  • Casno:

    196109-31-6

    High Quality 99% Exendin-4 (3-39) 196109-31-6 GMP Manufacturer

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.1-0.1

    1. Factory price and high quality must be guaranteed, base on 8 years of production and R&D experience2. Free samples will be provided,ensure specifications and quality are right for customer3. Customers will receive the most professional technical s

    Xi'an Xszo Chem Co. Ltd is a wholly-owned subsidiary of the SZO Chem Group. SZO Group is composed of Xi'an Xszo Chem Co. Ltd & Shaanxi SZO Tech Co., Ltd. SZO industry Group have mo

  •  Xi'an Xszo Chem Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-029-88698540

    Address:No.16,Jingqin Rd. JingWei Industrial park,Shaanxi,China,710200

       Inquiry Now

  • EXENDIN-4 (3-39)

  • Casno:

    196109-31-6

    EXENDIN-4 (3-39)

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • Exendin-4 (3-39)

  • Casno:

    196109-31-6

    Exendin-4 (3-39)

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0

    GMP standard, high purity, competitive price, in stock 1. Quick Response: within 6 hours after receiving your email. 2. Quality Guarantee: All products are strictly tested by our QC, confirmed by QA, and approved by a third-party lab in China, USA,

  •  Xiamen Jenny Chemical Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86

    Address:xiameng

       Inquiry Now

  • EXENDIN-4 (3-39)

  • Casno:

    196109-31-6

    EXENDIN-4 (3-39)

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. W

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, s

  •  Shandong Mopai Biotechnology Co., LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-15965530500

    Address:shandong

       Inquiry Now

  • 196109-31-6

  • Casno:

    196109-31-6

    196109-31-6

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High quality,stable supply chain.Appearance:white/off-white or light yellow Storage:Store in cool and dry place, keep away from strong light and heat. Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Application:This product can be use

    Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

  •  Suzhou Health Chemicals Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-512-58277800

    Address:No. 338, Jingang Avenue,

       Inquiry Now

  • Exendin-4 (3-39)

  • Casno:

    196109-31-6

    Exendin-4 (3-39)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    We are professional supplier in China for this product, we are dedicated to providing customers with the best quality, price, and service. Please feel free to send us inquiries.Appearance:Please contact us for product details Package:As per shipment

    Welcome to Sunny Pharmatech! Nanjing Sunny pharmatech Co., Ltd is a manufacturer and supplier of raw materials and ingredients for food and healthy supplement products, intermediat

  •  NANJING SUNNY PHARMATECH CO., LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-13814179829

    Address:No. 1704 SHUANGLONOG AVENUE, NANJING, CHINA

       Inquiry Now

  • Exendin 4 (3-39)

  • Casno:

    196109-31-6

    Exendin 4 (3-39)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    *High density and high throughput: simultaneous determination of tens of thousands of protein peptide biochemical reactions*High specificity: deeply reveal the protein binding mechanism, accurately locate the specific epitope of antibody and protein

  • Chinapeptides Co,. Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-021-50792271

    Address:Building 24A, 300 Chuantu Road, Chuansha, Pudong new area, Shanghai, China, 201202

       Inquiry Now

  • Exendin-4 (3-39)

  • Casno:

    196109-31-6

    Exendin-4 (3-39)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    We are a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates, polypeptide, and natural extract etc。We are capable to supply you with any quantity of the mentioned products with

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peptides

  • Wuhan Prominence Bio-technology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 18327075275

    Address:wuhan

       Inquiry Now

  • 196109-31-6

  • Casno:

    196109-31-6

    196109-31-6

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of Agricultural Sciences, Institute of Ecological Science Park, Beijing

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of

  • wuxi leji biology technology co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:18362718864

    Address:The Nanyue Road No. 2, Yixing City, Jiangsu Province

       Inquiry Now

  • Total:10 Page 1 of 1 1
Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 196109-31-6