Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 69 > 

69-78-3

Refine

Refine

Country

Business Type

Certificate

Display

Basic Information
CAS No.: 69-78-3
Name: 3-Carboxy-4-nitrophenyl disulfide
Molecular Structure:
Molecular Structure of 69-78-3 (3-Carboxy-4-nitrophenyl disulfide)
Formula: C14H8N2O8S2
Molecular Weight: 396.358
Synonyms: 2,2'-Dinitro-5,5'-dithiodibenzoicacid;3,3'-Dithiobis(6-nitrobenzoic acid);5,5'-Dithiobis[2-nitrobenzoic acid];Ba 2767;Dithionitrobenzoic acid;DTNB;
EINECS: 200-714-4
Density: 1.787 g/cm3
Melting Point: 240-245 °C (dec.)(lit.)
Boiling Point: 671.863 °C at 760 mmHg
Flash Point: 360.13 °C
Solubility: Soluble in water and ethanol.
Appearance: Yellow solid.
Hazard Symbols: IrritantXi
Risk Codes: 36/37/38
Safety: 26-36
PSA: 216.84000
LogP: 4.74520
Synthetic route
6950-43-2

5-bromo-2-nitrobenzoic acid

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

Conditions
ConditionsYield
With sodium sulfide In water at 50℃; for 2h; pH=> 3.5;72.3%
2516-95-2

5-chloro-2-nitrobenzoic acid

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

Conditions
ConditionsYield
With sodium sulfide; sodium hydroxide anschliessendes Behandeln mit Jod und KI;
75-91-2

tert.-butylhydroperoxide

15139-21-6

5-thio-2-nitrobenzoic acid

A

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

B

75-65-0

tert-butyl alcohol

Conditions
ConditionsYield
With ethylenediaminetetraacetic acid; MES buffer; selenosubtilisin (ESeSAr form) at 25℃; Rate constant; pH 5.5; other seleno- reagent, (Km)t-BuOOH;
15139-21-6

5-thio-2-nitrobenzoic acid

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

Conditions
ConditionsYield
With potassium hydroxide; dihydrogen peroxide In water
With dithionite(2-); cetyltrimethylammonim bromide In water Equilibrium constant;
With NaOH buffer; 1-phenylethyl hydroperoxide; seleno-subtilisin Carlsberg; citric acid at 20℃; pH=5.5; Enzyme kinetics; Oxidation;
77874-90-9

3-carboxylate-4-nitrothiophenoxide ion

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

Conditions
ConditionsYield
With 1-oxido-1,2-benziodoxol-3(1H)-one In water at 25℃; Kinetics; Rate constant; Mechanism; pH=8, μ=00.1(KCl), the reagent and the title compound were microencapsulated in vesicles of dioctadecyldimethylammonium chloride;
80-15-9

Cumene hydroperoxide

15139-21-6

5-thio-2-nitrobenzoic acid

A

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

B

617-94-7

1-methyl-1-phenylethyl alcohol

Conditions
ConditionsYield
Stage #1: 5-thio-2-nitrobenzoic acid With supramolecular artificial glutathione peroxidase (SGPxmax) In aq. phosphate buffer at 36℃; for 0.05h; pH=7; Enzymatic reaction;
Stage #2: Cumene hydroperoxide In aq. phosphate buffer Kinetics; Catalytic behavior; Reagent/catalyst;
With C17H28O3Te In aq. phosphate buffer; ethanol at 25℃; pH=7; Kinetics; Solvent;

C18H27NO5SSe

A

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

B

1204351-95-0

bis(11-hydroxyundecyl) diselenide

Conditions
ConditionsYield
Irradiation;
591-17-3

meta-bromotoluene

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

Conditions
ConditionsYield
Multi-step reaction with 3 steps
1: nitric acid; sulfuric acid / 2 h / 45 - 55 °C
2: potassium permanganate / water / 50 °C
3: sodium sulfide / water / 2 h / 50 °C / pH > 3.5
View Scheme
69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC disulfide

MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC disulfide

MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC* (C* = Cys-SS-3-carboxy-4-nitrophenyl)

MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC* (C* = Cys-SS-3-carboxy-4-nitrophenyl)

Conditions
ConditionsYield
Stage #1: MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC disulfide With D,L-dithiothreitol In aq. phosphate buffer at 37℃; for 0.333333h; pH=7.4;
Stage #2: 5,5'-dithiobis-(2-nitrobenzoic acid) In aq. phosphate buffer at 20℃; for 0.0333333h; pH=7.4;
100%
69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

15139-21-6

5-thio-2-nitrobenzoic acid

Conditions
ConditionsYield
With sodium tetrahydroborate In ethanol; water at 0 - 20℃;97%
With dithionite(2-); cetyltrimethylammonim bromide In water Kinetics; Equilibrium constant; further reagents, catalysts;
With 2-(N,N-dimethylamino)ethanol; 2-mercaptoethylamine hydrochloride In water at 25℃; for 1h; Yield given;
  • Display:default sort

    New supplier

  • 5,5 '-Dithiobis (2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5 '-Dithiobis (2-nitrobenzoic acid)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Yacoo Science is a leading provider of fine chemicals for a variety of industries. Our team of experts has over 20 years of experience in developing and producing high-quality chemicals, ensuring the highest level of purity and reliability. We are co

    Suzhou Yacoo Science Co., Ltd was founded in 2003. Via the innovation and development of more than 10 years, it has been a national high-tech enterprise specializing in "IVD Reagen

  •  SuZhou Yacoo Science Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-512-87182055

    Address:No.128 Fangzhou Rd, Suzhou Industrial Park, China, 215125, China

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 3.0-3.0

    As a leading manufacturer and supplier of chemicals in China, DayangChem not only supply popular chemicals, but also DayangChem's R&D center offer custom synthesis services. DayangChem can provide different quantities of custom synthesis ch

    Dayang Chem (Hangzhou) Co.,Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredi

  •  Dayang Chem (Hangzhou) Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-88938639

    Address:9/F, Unit 2 Changdi Torch Building, 259# WenSan Road, Xihu District, Hangzhou City 310012, P.R.China

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 15.0-15.0

    Company Information: Company Profile: 1.Professional: More than 10 years chemical exporting experience. We have produced chemical more than fifteen years, 95% products are for export . More than 10 years chemical exporting experience. Good and

    Gihichem is a professional chemical products manufacturer of nutrition supplements & dietary supplements. 99% purity for insurance the safety and effectiveness of our nutritional i

  •  GIHI CHEMICALS CO.,LIMITED

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-86217390

    Address:No.567 Dengcai Street,Sandun,Westlake District,Hangzhou310030,Zhejiang,China.

       Inquiry Now

  • High quality 5,5’-Dithiobis(2-Nitrobenzoic Acid) with high purity

  • Casno:

    69-78-3

    High quality 5,5’-Dithiobis(2-Nitrobenzoic Acid) with high purity

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

  •  Simagchem Corporation

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592-2680277

    Address:21/F Hualong Office Building,No.6 Hubin East Road, Xiamen,China

       Inquiry Now

  • 5,5′-Dithiobis(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5′-Dithiobis(2-nitrobenzoic acid)

    Min.Order: 1 Gram

    FOB Price:  USD $ 150.0-3500.0

    LIDE PHARMACEUTICALS LTD.was established in Apr.,2010. It is located in Jiangbei New District, Pukou District, Nanjing, which is the capital of total six dynasties in the Chinese history. We are a company that provides customized development and prod

    LIDE PHARMACEUTICALS LIMITED is one of the fastest growing pharmaceutical company in China. We have developed strategic partnership with our manufacturing associates having state o

  •  LIDE PHARMACEUTICALS LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-25-58409506

    Address:11F, Building A1, No.288 North Zhongshan Road, Gulou District, Nanjing,210003, P.R.China.

       Inquiry Now

  • 5,5'-Dithiobis(2-nitrobenzoic Acid) [for DeterMination of SH groups]

  • Casno:

    69-78-3

    5,5'-Dithiobis(2-nitrobenzoic Acid) [for DeterMination of SH groups]

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    he company has advanced technology, as well as a large number of excellent R & D team, to provide customers from the grams to one hundred kilograms and tons of high-quality products, competitive prices and quality se T rvice Appearance:White or

    Located in Zhengdong New District,?Zhengzhou of Henan province, Henan Allgreen Chemical Co.,Ltd is a comprehensive high-tech modern enterprises integrating professional R&D, pro

  •  Henan Allgreen Chemical Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-0371-87507775

    Address:No 260 Dongming Road,Jinshui District

       Inquiry Now

  • Factory Supply 5,5’-Dithiobis(2-Nitrobenzoic Acid)

  • Casno:

    69-78-3

    Factory Supply 5,5’-Dithiobis(2-Nitrobenzoic Acid)

    Min.Order: 1

    FOB Price:  USD $ 0.0-0.0

    The above product is Ality Chemical's strong item with best price, good quality and fast supply. Ality Chemical has been focusing on the research and production of this field for over 14 years. At the same time, we are always committed to providi

    Ality Chemical, established in 2007, is a comprehensive Chemical Production&Supply Group with Patent Technology as its core. Ality Chemical operates sales branches in Shanghai, Xia

  •  Ality Chemical Corporation

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-(0)592-8883942

    Address:Fine chemical industry park, Nantong,Jiangsu

       Inquiry Now

  • Amadis Chemical offer CAS#69-78-3;CAT#A836646

  • Casno:

    69-78-3

    Amadis Chemical offer CAS#69-78-3;CAT#A836646

    Min.Order: 10 Milligram

    FOB Price:  USD $ 0.0-0.0

    1.Professional synthesis laboratory and production base. 2.Strong synthesis team and service team. 3.Professional data management system. 4.We provide the professional test date and product information ,ex. HNMR ,CNMR,FNMR, HPLC/G

    Founded in 2011, Amadis Chemical Company Limited is an innovative manufacturer of chemical products and technical service providers. Our business includes sales, manufacture, and s

  •  Amadis Chemical Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-89925085

    Address:Watts Cosine.No.166.Xiangmao Road.

       Inquiry Now

  • 3,3'-Dithiobis-(6-nitrobenzoic acid)

  • Casno:

    69-78-3

    3,3'-Dithiobis-(6-nitrobenzoic acid)

    Min.Order: 5 Kiloliter

    FOB Price:  USD $ 1.2-5.0

    Our main production base is located in Xuzhou industry park. We are certified both to the ISO 9001 and ISO 14001 Standards, have a safety management system in place.Our R&D team masters core technology for process-design of target building block

    Our main production base is located in Xuzhou industry park. We produce a wide range of organics including Fine chemicals, Active pharmaceutical ingredients(APIs), Veterinary, In

  •  Chemwill Asia Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:021-51086038

    Address:High-Tech Industrial park,Chemical Economical Development Zone,Xuzhou, Jiangsu-Province, P.R.China

       Inquiry Now

  • 5,5'-Dithiobis(2-nitrobenzoic Acid) [for Determination of SH groups]

  • Casno:

    69-78-3

    5,5'-Dithiobis(2-nitrobenzoic Acid) [for Determination of SH groups]

    Min.Order: 1 Gram

    FOB Price:  USD $ 100.0-100.0

    Our main business covers the fields below: 1.Noble Metal Catalysts (Pt.Pd...) 2.Organic Phosphine Ligands (Tert-butyl-phosphine.Cyclohexyl-phosphine...) 3.OLED intermediates (Fluorene,Carbazole,Boric acid...) 4.Pharmaceutical intermediates

    Since our establishment in 2008,we have been exporting to more than 50 countries in Middle East, Europe and America. The production line covers different kinds of painting, plastic

  •  HENAN NEW BLUE CHEMICAL CO.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • Factory direct supply CAS 69-78-3 with best quality

  • Casno:

    69-78-3

    Factory direct supply CAS 69-78-3 with best quality

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 139.0-210.0

    WITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et

    Zhuo Zhou Wen Xi Import and Export Co., Ltd. is a company mainly engaged in the export of pharmaceutical raw materials. Its parent company is (Wen Xi Pharma), including three subs

  •  Zhuozhou Wenxi import and Export Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-13111626072

    Address:Room 1710, Baoxin International Phase I, 19 Guanyun East Road, Zhuozhou, Hebei

       Inquiry Now

  • High purity 5,5′-Dithiobis(2-nitrobenzoic acid) DTNB CAS 69-78-3 used as biochemical reagent

  • Casno:

    69-78-3

    High purity 5,5′-Dithiobis(2-nitrobenzoic acid) DTNB CAS 69-78-3 used as biochemical reagent

    Min.Order: 100 Gram

    FOB Price:  USD $ 10.0-10.0

    Wuhan Fortuna Chemical Co.,Ltd is a professional integrative chemical enterprise with 18 years exporting experience,which is being engaged in Pharmaceutical and its intermediates, Food and Feed additives, Fine chemicals. Appearance:Light yellow to ye

    Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

  •  Wuhan Fortuna Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-59207850

    Address:Add: Room 2015, No.2 Building, Kaixin Mansion No.107 Jinqiao Avenue, Wuhan, China

       Inquiry Now

  • 5,5-Dithiobis(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5-Dithiobis(2-nitrobenzoic acid)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1.0

    Name: 5,5-Dithiobis(2-nitrobenzoic acid) Molecular formula:C14H8N2O8S2 Molecular wt:396.34 CAS:69-78-3 Appearance:white-light yellow crystal powder Storage:Store in cool and dry place, away from sun light. Package:25kg Application:used in all kinds

    Welcome to Henan Sinotech! Sinotech Corporation has exceptional sourcing ability for chemicals used in Organic Fine Chemicals and APIs; Inorganic chemicals; Flame Retardants;OLED

  •  Henan Sinotech Import&Export Corporation

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-371-86181678

    Address:No. 260, Dongming Road,Jinshui District

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide CAS 69-78-3

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide CAS 69-78-3

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 3.0-10.0

    Our advantages: Hebei Dangtong Biological Technology Co., LTD.. is located in xingtai City, Hebei Province, China. It is a biotechnology enterprise engaged in the research, development, production and sales of animal and plant extracts, cosmetics, p

    Hebei Dangtong Biological Technology Co.,LTD was established in August 2021. It currently has more than 20 employees. Our factory currently has more than 500 employees. The company

  •  Hebei Dangtong Biological Technology Co..LTD

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-139-10575315

    Address:No.1722, Block C, Yangguang Xinzhuo Plaza, 256 Renmin West Road, Fuxing District, Handan City, Hebei Province

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 100 Kilogram

    FOB Price:  USD $ 0.0-0.0

    3-Carboxy-4-nitrophenyl disulfide Basic information Pr

    Henan Sunlake Enterprise Corporation is located in Henan Province , the central plain of China , which enjoys favorable geogeaphical position and convenient transportion. The compa

  •  HENAN SUNLAKE ENTERPRISE CORPORATION

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-371- 86259723

    Address:Mingmen International Center, NO.222 Dongming Road,Zhengzhou,Henan,China

       Inquiry Now

  • 99% Purity DTNB 5,5-Dithio-bis(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    99% Purity DTNB 5,5-Dithio-bis(2-nitrobenzoic acid)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1.0

    Appearance:White-light yellow crystal powder Storage:R.T Package:500G/Bottle or at customers requirement. Application:Widely used in biochemical research, it is a sensitive determination reagent for the research and production of biochemical reactio

    Founded in 2005, Sartort, located in Hangzhou, is a leading company engaging in chemistry, pharmaceutical and advanced materials. At present, Sartort has such controlled subsidi

  •  Hangzhou Sartort Biopharma Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-87039693

    Address:No. 57, Tech Park Road, Hangzhou, Zhejiang, China

       Inquiry Now

  • 5,5′-Dithiobis(2-nitrobenzoic acid) CAS:69-78-3

  • Casno:

    69-78-3

    5,5′-Dithiobis(2-nitrobenzoic acid) CAS:69-78-3

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    5,5′-Dithiobis(2-nitrobenzoic acid) CAS:69-78-3 Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, specializing in high qu

    Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, speciali

  •  Qingdao Beluga Import and Export Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+8613854236000

    Address:qingdao

       Inquiry Now

  • CAS NO.:69-78-3

  • Casno:

    69-78-3

    CAS NO.:69-78-3

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Henan Wentao Chemical Product Co.,Ltd is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds, which are widely used in the fields of prod

    The company is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds,

  •  Henan Wentao Chemical Product Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-370-2722992

    Address:32 Room, 5th Floor, Building 11, No. 6 Yinxing Road, High-tech Industrial Development Zone, Zhengzhou City, Henan Province

       Inquiry Now

  • 5,5’-Dithiobis(2-Nitrobenzoic Acid)

  • Casno:

    69-78-3

    5,5’-Dithiobis(2-Nitrobenzoic Acid)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Best quality & Attractive price & Professional service; Trial & Pilot & Commercial Hisunny Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality intermediates, specia

    Hisunny Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality intermediates, special chemicals and OLED materials &

  •  Xiamen Hisunny Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-592-3327115

    Address:Unit 603,No.879,Xiahe Road,Meixin Building,Xiamen,China

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Hello, Dear friend! I'm Hanson from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by email in time. produc

    Shandong Hanjiang Chemical Co., Ltd. is located in Zibo City, Shandong Province, China. It is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids

  •  Shandong Hanjiang Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 18369939125

    Address:No.25A Qilu Industrial Park

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0

    Hangzhou KeyingChem Co., Ltd. exported this product to many countries and regions at best price. If you are looking for the material’s manufacturer or supplier in China, KeyingChem is your best choice. Pls contact with us freely for getting det

    Hangzhou Keying Chem Co., Ltd. Is a comprehensive enterprise, dedicated to the development, production and marketing of chemicals. As a technology innovative and service profession

  •  Hangzhou Keyingchem Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-85378921

    Address:Jintong international Building, No.113,Huayuangang Street, Gong shu District, Hangzhou,Zhejiang, China.

       Inquiry Now

  • 5,5′-Dithiobis(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5′-Dithiobis(2-nitrobenzoic acid)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Hello, dear friend! Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by email in time. product quality 1.The product quality h

    Suzhou senfeida Chemical Co., Ltd. is located in Hushuguan economic and Technological Development Zone, Suzhou high tech Zone. It is a civilian chemical enterprise that produces an

  •  Suzhou Senfeida Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:186-624-33356

    Address:Hushuguan Economic and Technological Development Zone, Suzhou High-tech Zone

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    J&H CHEM R&D center can offer custom synthesis according to the contract research and development services for the fine chemicals, pharmaceutical, biotechnique and some of the other chemicals. J&H CHEM has some Manufacturing base in Jia

    J&H Chemical is one of China's leading providers of integrated fine chemical services including offering, research and development, Custom manufacturing business, as well as other

  •  Hangzhou J&H Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-87396432

    Address:No.200 Zhenhua Rd.Xihu Industrial Park, Hangzhou 310030, China

       Inquiry Now

  • High quality 5,5-Dithiobis(2-nitrobenzoic acid) (Dtnb) with factory price

  • Casno:

    69-78-3

    High quality 5,5-Dithiobis(2-nitrobenzoic acid) (Dtnb) with factory price

    Min.Order: 1 Gram

    FOB Price:  USD $ 15.0-20.0

    our strengths: 1: Fast and guaranteed shipment (TNT;EMS;FEDEX;DHL;UPS;EUB, special line) 2: Various payment items accepted (Btc; MoneyGram; WU) 3: Valued package (Paraffin coating; Double aluminum foil bag; Vacuum packaging) 4: Efficient delivery

    Established in 2010, located in Hangzhou Qinglan science park, lingruichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various

  •  Hangzhou Lingrui Chemical Co.,Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86 571-88092529-

    Address:No. 176, Zixia Road, Xihu District Hangzhou City,CHINA

       Inquiry Now

  • High purity5,5′-Dithiobis(2-nitrobenzoic acid)(DTNB)DTNB

  • Casno:

    69-78-3

    High purity5,5′-Dithiobis(2-nitrobenzoic acid)(DTNB)DTNB

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • 5,5'-Dithio-bis-(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5'-Dithio-bis-(2-nitrobenzoic acid)

    Min.Order: 100 Gram

    FOB Price:  USD $ 1.9-2.9

    Appearance:liquid Storage:Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials. Package:Grams, Kilograms Application:For R&D and commerical use Transportati

    We are a team of industry experts, dedicated to delivering the best chemical solutions from quality suppliers across China. Putting our customers first, we take a holistic approach

  •  Chemlyte Solutions

    China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-189 8945 5137

    Address:Jian Qiao Community, 789 Shenhua Road, Xihu District, Hangzhou, China, 310000

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0

    Massive Chemical is certified with ISO9001 and ISO14001 manufacturer for this product. We will offer all documents as requirement for the materials which includes, Certificate of Analysis, Material Safety Data Sheet, and Method of Analysis and

    Shanghai Massive Chemical Technology Co., Ltd. is engaged in development, production and marketing Specialty Chemicals to satisfy the changing needs of the chemical industry. We sp

  •  Shanghai Massive Chemical Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 21 34943721

    Address:Room 435, 4th floor, Building 9, No. 2568 Gudai Road,Minhang District, Shanghai,

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Hangzhou Johoo Chemical Co., Ltd will provide you with the most favorable prices and the highest quality products and services. We will be at your service at any time, providing you COA, MSDS, Prices, Delivery times, and payment terms Hangzhou Jo

    Hangzhou Johoo Chemical Co., is located in the beautiful tourist city of hangzhou. It is a biotechnology enterprise engaged in the R&D, production and sales of fine chemicals, food

  •  Hangzhou Johoo Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-87219818

    Address:Room B25, 2-6F, Dongfangmao Commercial Center, No. 698 Changbang Road, Hangzhou, China

       Inquiry Now

  • 5,5'-Dithio-bis(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5'-Dithio-bis(2-nitrobenzoic acid)

    Min.Order: 50 Milligram

    FOB Price:  USD $ 0.0-0.0

    We are a leading chemical and life science company focused on making science and discovery easier, distributes Chemicals, Biochemical and other essential Lab products. We have strict QC for All products, and they are tested by NMR\HPLC\GC, most of

    Shenzhen Regent Biochemistry Tech Co., Ltd. is a leading chemical and life science company focused on making science and discovery easier, distributes Chemicals, Biochemical and ot

  •  Shenzhen Regent Biochemistry Tech Co., Ltd.

     Hong Kong,China  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-755-85201366

    Address:PINGSHAN DIS., BAOSHAN INDUSTRIAL AREA

       Inquiry Now

  • 5,5'-Dithiobis(2-nitrobenzoic acid) ,99%

  • Casno:

    69-78-3

    5,5'-Dithiobis(2-nitrobenzoic acid) ,99%

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Product Details Grade: pharmaceutical grade Purity:99%+ ProductionCapacity: 1000 Kilogram/Month Scope of use: For scientific research only(The product must be used legally) Our Advantage 1. Best quality with competitive price. 2. Qui

    RongNa Biotechnology Co.,Ltd is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids, peptides, raw materials, vitamins, food additives, animal an

  •  RongNa Biotechnology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-18560316533

    Address:No. 416, 4th floor, zhongguancun science and technology city, no. 1, west 6th road, zhangdian district

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Product Name: 5,5′-Dithiobis(2-nitrobenzoic acid) Synonyms: DTNB;ellmann's reagent;ELLMAN'S REAGENT;ELLMANS' REAGENT;BIS(3-CARBOXY-4-NITROPHENYL) DISULFIDE;3-CARBOXY-4-NITROPHENYL DISULFIDE;Ellmsn'sreagent;Bis(3-carboxy-4-

    SHANGHAI MINSTAR CHEMICAL CO., LTD. is a leading, experienced, professional supplier of API & intermediates, make-to-order, plant extract, food additive, fine chemicals and industr

  •  Shanghai Minstar Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-21-18019205509

    Address:BUILDING 8, NO.1098, CHUANSHA ROAD, SHANGHAI, CHINA

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Milligram

    FOB Price:  USD $ 10.0-10.0

    Q1:Are you manufacturer or trading company? A1: Manufacturer. Q2: Can I get some sample? A2: Yes Q3: What's your MOQ? A3: Our MOQ is flexible.different price for different quantity Q4: Is there a discount? A4: Of course, welcome to contact us.

    WEIFANG YANGXU GROUP Co., Ltd was founded in 1996. More than 20 years full efforts, YANGXU chemical has grown to be a large enzyme peptide chemical enterprise, specializing in expl

  •  weifang yangxu group co.,ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+08613666361637--

    Address:No 5.dongfeng east street.gaoxin district.weifang city.

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Hangzhou ZeErRui Chemical Co., Ltd. located in Lingang industrial areas, our plant covers an area of 6000 square meters.ZeErRui dedicated to the development, production and marketing of chemicals. We have earned ourselves a good reputation at home an

    Hangzhou ZeErRui Chemical Co., Ltd. located in Lingang industrial areas, our plant covers an area of 6000 square meters.ZeErRui dedicated to the development, production and marketi

  •  Hangzhou ZeErRui Chemical Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-82512721

    Address:No 317,Jingling Road,Guali Town,Xiaoshan District

       Inquiry Now

  • 69-78-3  CAS NO.69-78-3

  • Casno:

    69-78-3

    69-78-3 CAS NO.69-78-3

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 7.0-8.0

    1.Applied in food field.it can improve the immune system and prolong life. 2.Appliedin cosmetic field.it can improve the skin care. 3.Applied in pharmaceutical field.it can treat various dieases. 4.Our product quality assurance will make our customer

    KAISA GROUP INC.is the enterprise which is specialize in manfacturing and exporting avariety of Chemical in China. We have the strong economic base and comprehensive technology.We

  •  KAISA GROUP INC

    United States  |  Contact Details

    Business Type:Trading Company

    Tel:15131197030

    Address:1312 17th Street Suite 1402 Denver CO 80202

       Inquiry Now

  • 5,5-DITHIO-BIS(2-NITROBENZOIC ACID)

  • Casno:

    69-78-3

    5,5-DITHIO-BIS(2-NITROBENZOIC ACID)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Hangzhou Huarong Pharm Co., Ltd.established since 2006 , has been actively developing specialty products for Finished Dosages, APIs, Intermediates, and Fine chemicals markets in North America, Europe, Korea, Japan, Mid-East and all over the World. Hu

    Hangzhou Huarong Pharm Co., Ltd. established since 2009 , has been always focusing on supplying products and services to our clients in the field of small molecule drug. Huarong

  •  Hangzhou Huarong Pharm Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-571-86758373

    Address:Room1101, Hakim International Building, Gongshu District, Hangzhou, Zhejiang Province, China.

       Inquiry Now

  • 5,5′-Dithiobis(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5′-Dithiobis(2-nitrobenzoic acid)

    Min.Order: 1 Gram

    FOB Price:  USD $ 2.0-2.0

    Hangzhou KieRaychem Co.,Ltd.is located in Yuhang District of Hangzhou City and specialized in the chemical product customization, development, sales, import and export. Current business is focused on fine chemicals, pharmaceutical materials and inter

    Hangzhou KieRaychem Co.,Ltd.is located in Yuhang District of Hangzhou City and specialized in the chemical product customization, development, sales, import and export. Current bus

  •  Hangzhou KieRay Chem Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-0571-56123425

    Address:No. 76 Xingqiao North Road, Xingqiao Street, Yuhang District, Hangzhou City, Zhejiang Province, China

       Inquiry Now

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1 Customer Service

What can I do for you?
Get Best Price

Get Best Price for 69-78-3

Chemistry

Product Name: Dithionitrobenzoic acid (CAS NO.69-78-3)

MF: C14H8N2O8S2
MW: 396.35
IUPAC: 5-(3-carboxy-4-nitrophenyl)disulfanyl-2-nitrobenzoic acid
EINECS: 200-714-4
Melting point: 240-245 °C (dec.)(lit.)
Solubility in water: Soluble
storage temp.: Store at RT.
Appearance: Yellow solid.
Categories: Phenyls & Phenyl-Het;Phenyls & Phenyl-Het
Stability: Stable under normal temperatures and pressures.
Incompatibilities: Strong oxidizing agents.
Decomposition: Nitrogen oxides, carbon monoxide, oxides of nitrogen, oxides of sulfur, irritating and toxic fumes and gases, carbon dioxide, nitrogen.
Synonyms: 3-Carboxy-4-nitrophenyl disulfide; 2,2'-Dinitro-5,5'-dithiodibenzoic acid;  3,3'-Dithiobis(6-nitrobenzoic acid); 5-(3-Carboxy-4-nitrophenyl)disulfanyl-2-nitrobenzoic acid; DTNB

Uses

 Dithionitrobenzoic acid (CAS NO.69-78-3) is used as sensitive reagents to determination sulfhydryl group in protein and polypeptide. Dithionitrobenzoic acid is also used for the monitoring of organophosphorus pesticide poisoning(Cholinesterase determination).

Toxicity Data With Reference

1.    

ipr-mus LD50:2080 mg/kg

    ARZNAD    Arzneimittel-Forschung. Drug Research. 21 (1971),284.

 

Consensus Reports

Reported in EPA TSCA Inventory.

Safety Profile

Moderately toxic by intraperitoneal route. When heated to decomposition it emits toxic vapors of NOx and SOx.
Hazard Codes: Xi
Risk Statements: 36/37/38: Irritating to eyes, respiratory system and skin  
Safety Statements: 26-36
26:  In case of contact with eyes, rinse immediately with plenty of water and seek medical advice 
36:  Wear suitable protective clothing  
WGK Germany: 3
F: 10: Keep under argon.
HS Code: 29309070

Specification

1. First Aid Measures:
Ingestion: If victim is conscious and alert, give 2-4 cupfuls of milk or water. Never give anything by mouth to an unconscious person. Get medical aid.
Inhalation: Remove from exposure to fresh air immediately. If not breathing, give artificial respiration. If breathing is difficult, give oxygen. Get medical aid.
Skin: Flush skin with plenty of soap and water for at least 15 minutes while removing contaminated clothing and shoes. Get medical aid if irritation develops or persists. Wash clothing before reuse.
Eyes: Immediately flush eyes with plenty of water for at least 15 minutes, occasionally lifting the upper and lower eyelids. Get medical aid immediately.