863288-34-0

CJC-1295 Muscle Growth Peptides CJC-1295 NO DAC CAS 863288-34-0 Modified GRF 1-29

Min.Order: 10 Metric Ton

FOB Price:  USD $ 0.0-0.0/Metric Ton

Cas No. 863288-34-0 Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC Molecular Formula: C152H252N44O42 MW: 3367.97 Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser

Changzhou Biolistech Co.,Ltd. is one high-tech biological enterprise, established in 2012, our company has been focusing on production and sales of HGH products, peptides products,

Peptides Bodybuilding cjc-1295 cjc 1295 Without dac 863288-34-0

Min.Order: 1 Milligram

FOB Price:  USD $ 1.0-1.0/Milligram

We promise our customer following items 1.Reasonable price: We provide high quality products with competitive price in china, 2.Low moq: No worry about the low moq, our moq is 1 gram or lower. 3.Good and efficient service,Fast Delivery

SHANDONG SIGMACHEMICAL is mainly engaged in R&D, manufacturing and marketing pharmaceuticals, chemical intermediates, Biochemicals, Veterinary medicines and Nutrition products. Wit

CJC-1295

Min.Order: 1 Gram

FOB Price:  USD $ 10.0-10.0/Gram

Zhejiang J&C Biological Technology Co., Limited is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including Intermediates &a

ZHEJIANG BIOLOGY AND TECHNOLOGY CO., LTD. is a modern professional high-tech enterprise, which is specializing in generic APIs and pharmaceutical intermediates. especially in pepti

USP GMP manufacturer bodybuilding peptides cjc-1295 cjc dac 1295

Min.Order: 1 Gram

FOB Price:  USD $ 65.0-65.0/Gram

1, High quality with competitive price: 1) Standard:BP/USP/EP/Enterprise standard 2) All Purity≥99% 3) We are manufacturer and can provide high quality products with factory price. 2, Fast and safe delivery 1) Parcel can be se

CJC-1295 without DAC 2mg/vial peptides fo bodybuilding

Min.Order: 0 Metric Ton

FOB Price:  USD $ 0.0-0.0/Metric Ton

Rich experience. We have specialized in this field for 7 years. Our steroids and hormones have been exported to overseas, like Europe, Africa, Asia, America and other countries. And we have got very good feedback from our customers, and establish

Hubei God bull Pharmaceutical Co.,Ltd is a leading pharmaceutical and plant extract factory which is special in steroid powder and pahrmaceutical intermediate,plant extract. .Acco

Casno:

863288-34-0

MSDS/COA Download

Cjc 1295 with dac

Min.Order: 1 Gram

FOB Price:  USD $ 107.5-110.0/Gram

1.Free sample and the price is reasonable. 2.low freight with the fast delivery. 3.payment assurance, 24 hours service,the goods is high purity, 4.It have good effect,good feedback, lead time:1-3 days, 5.payment terms: TT, alibaba, western

CJC-1295 Muscle Growth Peptides CJC-1295 NO DAC CAS 863288-34-0

Min.Order: 1 Gram

FOB Price:  USD $ 1.0-1.0/Gram

HuBei ipure is a diversified product production and operation enterprise, with API, pharma intermediates, and other fine chemicals as well as R&D and pigments development and sales as one of the large enterprises, with more than 130 acres of

Hubei Ipure biotech Co., Ltd. is Established in 2011,which is located in Wuhan, Hubei Province where is the largest city in central China. The company is a diversified product pr

Casno:

863288-34-0

MSDS/COA Download

CJC 1295 (2mg/vial) CAS NO.863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 1.0-3.0/Kilogram

Quick Details ProName: CJC 1295 (2mg/vial) CasNo: 863288-34-0 Molecular Formula: C152H252N44O42 Appearance: white Application: Bodybuilding DeliveryTime: 3-4 days PackAge: Disguised package Port: Hongkong Pr

Hebei yanxi chemical co. LTD. has expanded a compositive entity from initially only as a small manufacturer. The company dedicated to the development, production and marketing of

CJC-1295 Acetate CAS NO.863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.0-0.0/Kilogram

Hubei Jusheng Technology Co., Ltd., is a global chemical industry manufacturers and suppliers of pharmaceuticals and intermediates in China. The yearly production capacity is 50000MT, 80% for export.We have a professinal export team. Both by Air a

Hubei Jusheng Technology Co., Ltd., is a large group corporation which engaged in the R&D and manufacture of chemicals, Pharmaceuticals and intermediates. We have earned ourselves

High quality CJC-1295 supplier in China

Min.Order: 0

FOB Price:  USD $ 0.0-0.0/

Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our c

Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

Factory supply CJC-1295 Cas 863288-34-0 with DAC with high quality and favorable price

Min.Order: 1 Gram

FOB Price:  USD $ 17000.0-17500.0/Gram

Unique advantages for CJC-1295 Cas 863288-34-0 Guaranteed purity High quality & competitive price Quality control Fast feedback Prompt shipment Appearance:White powder Storage:N/A Package:2mg/vial,10vials/box Application:Medicine

Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

Casno:

863288-34-0

MSDS/COA Download

Injection White Lyophilized Peptide Powder CJC-1295 without DAC

Min.Order: 1 Gram

FOB Price:  USD $ 3.0-3.0/Gram

Dayangchem's R&D center can offer custom synthesis according to the contract research and development services for the fine chemicals, pharmaceutical, biotechnique and some of the other chemicals. DayangChem can provide different quantities

Hangzhou Dayangchem Co.,Ltd dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(

CJC1295

Min.Order: 100 Kilogram

FOB Price:  USD $ 0.0-0.0/Kilogram

CJC1295 Basic information

Henan Sunlake Enterprise Corporation is located in Henan Province , the central plain of China , which enjoys favorable geogeaphical position and convenient transportion. The compa

98% Quality Protein Peptide Hormones 2Mg/vial White Cjc1295 Without Dac CAS 863288-34-0

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Our Adwantage: 1.We have stock so we can delivery quickly at the very day when receive the payment. 2.Best price, first class service, high successful delivery rate. A discount would be given when you make a large order. 3.High quality gua

Hubei Xinrunde Chemical Co., Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(s)

Factory supply Raw materials and injection 99% CJC1295 CJC-1295 2mg With fast and safe shipping

Min.Order: 1 Gram

FOB Price:  USD $ 70.0-70.0/Gram

Name: Cjc-1295 DAC Customized: Customized Suitable for: Adult Purity: >99% Usage: Pharmaceutical Intermediates Powder: Yes State: Solid MW: 3649.3 MF: C165h271n47o46 Purity (HPLC): 99.0% Appearance: White Powder CJC-1295, also known

Shaanxi Mingqi Chemical Co., Ltd is committed to the development of import and export trade in the production, operation and plant extracts of pharmaceutical raw materials and inte

Global Sell Cjc-1295 Without Dac, Cjc1295 No Dac, CJC 1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 100.0-100.0/Kilogram

Sincere recruitment of global agents, preferential conditions! whatsapp/wechat:+8615130202468 Sample for free! Crovell is specialized in pharmaceutical intermediates, veterinary drug intermediates and dyes intermediates,suc

Thanks for your considering of Crovell Biotech (Hebei) Co., Ltd. Crovell is a fast growing intermediates company,Which located in Shijiazhuang,Hebei Province. Crovell is speciali

Best price Cjc-1295 With Dac 2mg/vial 5mg/vial 10mg/vial

Min.Order: 20 Milligram

FOB Price:  USD $ 0.0-0.0/Milligram

Items Specifications Product Name Cjc-1295 With Dac Appearance White powder Identification

Changzhou Xuanming Chemical CO, LTD is dedicated to the technology development, manufacturing, import and export chemicals, which are specialized in pharmaceutical intermediates, p

Casno:

863288-34-0

MSDS/COA Download

CJC-1295 with high quality &low price

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Country of origin : China Port: Shanghai Shenzhen Qingdao Hongkong PackAge: Zip lock Bag , Vacuum sealed foil packaging, Carton packing ,Export grade fiber drum or as customers’ requirement. Purity: 99%min Storage: keep in dry and c

HUBEI AOKS BIO-TECH CO.,LTD is located in Hubei province of China.We specialized in Active pharmaceutical ingredient,pharmaceutical intermediates,veterinary drug intermediates and

cjc 1295 DAC Muscle Peptides bodybuilding cjc1295 with dac

Min.Order: 1 Kilogram

FOB Price:  USD $ 25.0-35.0/Kilogram

Product Description CJC-1295 is basically a peptide hormone that acts similar to growth hormone releasing hormones (GHRH). It achieves this by preventing degradation of its amino acids. With a single dose, it can remain in the body for quite a

Tansen Yiang CO., LIMITED specializes in exporting high quality Research chemical,Basic chemical and so on. Our products are produced on the basis of best technical team, advanced

CJC1295 DAC

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Xi'an Yinherb Bio-Tech Co., Ltd was founded in 2009, We have more than 10 experienced doctors and scientists and professional managers, specializing in Nootropics, Sarms and Peptides researching and developing, and become the lead

Xi'an Yinherb Bio-Tech Co., Ltd was founded in 2009, We have more than 10 experienced doctors and scientists and professional managers, specializing in Nootropics,Sarms and Peptide

CJC-1295 with DAC

Min.Order: 10 Milligram

FOB Price:  USD $ 0.0-0.0/Milligram

cas no. 863288-34-0 synonyms: cjc-1295 without dac, cjc 1295 w/o dac molecular formula: c152h252n44o42 mw: 3367.97 sequence: tyr-d-ala-asp-ala-ile-phe-thr-gln-ser-tyr-arg-lys-val-leu-ala-gln-leu-ser-ala-arg-lys-leu-leu-gln-as

Biochem-lab company has established a broad customer base in the Research Chemical and pharmaceutical industry in Russia, USA and European countries, and built close relationships

CJC-1295 with DAC Peptides for Muscle Gaining Injectable CAS NO.863288-34-0

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Minimum Order Qty. 10 Gram

We, Jilin Tely Imp & Exp Co., Ltd. mainly supply and export products including: pharmaceutical raw materials,Chemical reagents, Food additives, pharmaceutical and pesticide interme

Casno:

863288-34-0

MSDS/COA Download

CJC1295 Without DAC manufacturer

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Our Advantages: 1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%. 2. Samples free trial: our company welcome samples to test our quality the

Hangzhou Peptidego Biotech. Co.,Ltd is an internationally recognized biochemical manufacturing company which specialized in the production of peptide reagents, custom peptides and

Casno:

863288-34-0

MSDS/COA Download

low price CJC-1295 CJC-1295 on hot sellingBest price 863288-34-0

Min.Order: 2 Milligram

FOB Price:  USD $ 660.0-790.0/Milligram

Quality & Price 1. Factory price, reliable quality 2. Years produce and exporting experience 3. Strict quality control, free sample for test before order, keep sample after shipment for further issue Service 1. Enough stock, fas

Wuhan Xinru Chemical Industry Co.,Ltd founded in 2006. It's an integrated chemical company involved in R&D, distribution and outsourcing. Taking the unique resource advantage of

CJC 1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.0-0.0/Kilogram

Our Services 1. New Molecules R&D 2. Own test center HPLC NMR GC LC-MS 3. API and Intermediates from China reputed manufacturers 4. Documents support COA MOA MSDS DMF open part Our advantages 1. Government awarded company. Top 100 enter

AFINE CHEMICALS LIMITED is specialized in the fine chemicals and pharmaceuticals and we have enjoyed great popularity in world markets. Since 2005, we have been rapidly growing to

Global Sell CJC-1295 Without Dac, CJC1295 No Dac, Cjc 1295

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Sichuan Jisheng Biopharmaceutical Co.,Ltd is specializing of peptide and pharmaceutical intermediates. all of our products are produced in accordance with GMP standard and are exceeded in international quality standards. We are a leading peptide

Our company is located in Deyang, a typical city of Sichuan - with beautiful scenery and mild climate. It occupies a total area of 16,000 square meters. We are a specialized manufa

High quality CJC-1295 DAC CJC-1295 no/without DAC

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

1.high quality: quality is life. quality is the most important element for all goods. we have a lab doing research in wuhan china. hplc and nmr is available if needed. 2.reasonable price: we provide high quality products with competi

Wuhan WONDA PHARMACEUTICAL AND CHEMICAL LIMITED is specializing in custom synthesis, manufacture and import & export of fine chemicals, APIs and pharmaceutical intermediates. WOND

Injection White Lyophilized Peptide Powder CJC-1295 without DAC CAS NO.863288-34-0

Min.Order: 1 Gram

FOB Price:  USD $ 1.0-1.0/Gram

FAQ 1. Can I get a free sample Yes, but you have to pay the courier fee. 2. How to pay We accept payments in the form of Western Union, MoneyGram, Bitcoin, etc. 3. What should I do if we don’t ship after payment We are a formal c

In 2009, Dr Zhang Lin from Johns Hopkins University founded the theta Biological Laboratory. He is committed to the study of protein assimilation preparations. In 2013,Dr Zhang Li

Top Quality Peptide Powder CJC-1295 (Without DAC)

Min.Order: 1 Gram

FOB Price:  USD $ 5.0-10.0/Gram

Strong backup of facotry: high R&D ability, favorable quality and competitive price 2. Stock avaliability 3. Flexible business way, like payment term and product delivery 4. Fast response 24*7 5. A good troubleshooter/very positive atti

Beijing Yibai Biotechnology Co., Ltd, backed up with factory toppest support with high R&D ability, we have confidence to make you more competitive on market. Yibai is devoting fo

CJC-1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 100.0-100.0/Kilogram

HangYu Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. HangYu Chemical consis

Zibo HangYu Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals

CJC-1295 DAC CAS NO.863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.0-0.0/Kilogram

1.High quality and competetive price 1)for prulifloxacin exported we can offer coa certificate and official invoice. 2)we are manufacturer with own lab and factory, can provide high quality products with factory price. 3)products purity is tes

Wuhan New-Rise biochem Co.,Ltd. is a leading provider and manufacturer of pharmaceutical and chemical products. We are dedicated in providing a wide variety of quality API, pharm

Casno:

863288-34-0

MSDS/COA Download

Cjc-1295 for Muscle Enhance

Min.Order: 10 Metric Ton

FOB Price:  USD $ 10.0-30.0/Metric Ton

Superiority 1.As a professional production leading factory & lab in China in pharmaceutical area of 15 years, our market to USA, Australia, Middle East, Germany, Spain, UK, and so on other country. What’s more, good feedback from ou

Filter Biotechnology Co., Ltd is a High-Tech Bio-Chemical Enterprise which is integrated by Professional Scientific R&D, Mass production and Sales. As a world-leading Provider

CJC-1295 Acetate without DAC

Min.Order: 0

FOB Price:  USD $ 0.0-0.0/

high quality & timely delivery Storage:MSDS reference Package:Bag/Bottle/Drum Application:organic and speciality chemicals Transportation:by courier/air/sea Port:Shanghai

Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

Factory supply Peptide CAS NO. 863288-34-0 CJC 1295 DAC

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Factory supply Peptide CAS NO. 863288-34-0 CJC 1295 DAC 1.Professional manufaucture and supplier 2.High purity 3.Lowest price 4.Powerful and professional forwarder Appearance:White powder Storage:Stored in the dry and ventilated inside stor

CJC 1295

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Superior quality, moderate price & quick delivery. Appearance:White Lyophilized Powder Storage:Stored in cool, dry and ventilation place; Away from fire and heat Package:1kg/bag, 1kg/drum or 25kg/drum or as per your request. Application:Used as

Hangzhou Yunuo Chemical Co., Ltd. is located in Hangzhou City, China We are specialized in fine chemicals and basic chemical auxiliary materials, Organic compounds, rubber

TIANFUCHEM--CJC1295

Min.Order: 1 Metric Ton

FOB Price:  USD $ 20.0-20.0/Metric Ton

Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl

Our company engages in Electronic chemicals such as OLED，Photoresist chemical，Electrolyte additive and Intermediate Pharmaceutical production; development of noble metal catalysts,

CJC1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.9-1.0/Kilogram

LIDE PHARMACEUTICALS LIMITED is a professional chemicals and APIs leading manufacturer in China. Our core business line covers APIs, Intermediates, Herb extract, etc.

LIDE PHARMACEUTICALS LIMITED is one of the fastest growing pharmaceutical company in China. We have developed strategic partnership with our manufacturing associates having state o

Casno:

863288-34-0

MSDS/COA Download

Injection White Lyophilized Peptide Powder CJC-1295 without DAC CAS NO.863288-34-0

Min.Order: 1 Gram

FOB Price:  USD $ 1.0-1.0/Gram

Our advantage:1. Professional R&D and production personnel.Our engineers are Ph.D. in chemistry and medicine, and the production staff are all university graduates.So we can do good quality management because we have a wealth of quality managem

Guangzhou XinKe Chemical Co., LTD is a leading Chinese chemical supplier specialized in hormone steroid powders, Steroids injectable liquids, our company integrates R&D, producing,