Welcome to LookChem.com Sign In|Join Free
  • or
Home > Products > 863288 > 

863288-34-0

Basic Information
CAS No.: 863288-34-0
Name: CJC 1295
Molecular Structure:
Molecular Structure of 863288-34-0 (CJC 1295)
Formula: C159H258N46O45
Molecular Weight: 3534.03
Synonyms: CJC-1295;
EINECS:
Density:
Melting Point:
Boiling Point:
Flash Point:
Solubility:
Appearance: White Lyophilized Powder
Hazard Symbols:
Risk Codes:
Safety:
Transport Information:
  • Display:default sort

    New supplier

  • More 98% High Pure Peptide CJC-1295 with DAC CAS 863288-34-0 for Muscle Mass and Weight Loss

  • Casno:

    863288-34-0

    More 98% High Pure Peptide CJC-1295 with DAC CAS 863288-34-0 for Muscle Mass and Weight Loss

    Min.Order: 10 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    Cas No. 863288-34-0 Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC Molecular Formula: C152H252N44O42 MW: 3367.97 Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser

    Changzhou Biolistech Co.,Ltd. is one high-tech biological enterprise, established in 2012, our company has been focusing on production and sales of HGH products, peptides products,

  •  Biolistech

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-136-5150-4862

    Address:Xinbei disctrict, Hehai Road

       Inquiry Now

  • Peptides Bodybuilding cjc-1295 cjc 1295 Without dac 863288-34-0

  • Casno:

    863288-34-0

    Peptides Bodybuilding cjc-1295 cjc 1295 Without dac 863288-34-0

    Min.Order: 1 Milligram

    FOB Price:  USD $ 1.0-1.0/Milligram

    We promise our customer following items 1.Reasonable price: We provide high quality products with competitive price in china, 2.Low moq: No worry about the low moq, our moq is 1 gram or lower. 3.Good and efficient service,Fast Delivery

    SHANDONG SIGMACHEMICAL is mainly engaged in R&D, manufacturing and marketing pharmaceuticals, chemical intermediates, Biochemicals, Veterinary medicines and Nutrition products. Wit

  •  Qingdao Sigma Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-186617792112

    Address:shandong qingdao

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    CJC-1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 10.0-10.0/Gram

    Zhejiang J&C Biological Technology Co., Limited is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including Intermediates &a

    ZHEJIANG BIOLOGY AND TECHNOLOGY CO., LTD. is a modern professional high-tech enterprise, which is specializing in generic APIs and pharmaceutical intermediates. especially in pepti

  •  Zhejiang J&C Biological Technology Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15857007529

    Address:46# zhongshan road, quzhou zhejiang

       Inquiry Now

  • CJC 1295 Anti Aging Peptides CJC-1295 With DAC for Bodybuilding Supplements

  • Casno:

    863288-34-0

    CJC 1295 Anti Aging Peptides CJC-1295 With DAC for Bodybuilding Supplements

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    1) Our company is a professional raw powder factory in China for over 16 years, all powders are factory directly supplying. 2) Our products have exported to Germany, Norway, Poland, Finland, Spain, UK, France, Russia, USA, Australia, Japan, Kore

    Tai'an Jia Ye Biological Technology Co.,Ltd is a comprehensive and high-tech enterprise special in pharmaceutical intermediate,Integrating R & D, Manufacturing, Operating and Marke

  •  Tai'an Jia Ye Biological Technology Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-0538-6309326

    Address:Great Wall Road 6, Tai'an City,Shandong Province,China

       Inquiry Now

  • CJC-1295 without DAC 2mg/vial peptides fo bodybuilding

  • Casno:

    863288-34-0

    CJC-1295 without DAC 2mg/vial peptides fo bodybuilding

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    Rich experience. We have specialized in this field for 7 years. Our steroids and hormones have been exported to overseas, like Europe, Africa, Asia, America and other countries. And we have got very good feedback from our customers, and establish

    Hubei God bull Pharmaceutical Co.,Ltd is a leading pharmaceutical and plant extract factory which is special in steroid powder and pahrmaceutical intermediate,plant extract. .Acco

  •  Hubei God bull Pharmaceutical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-027-52341258

    Address:No.58, guanggu avenue, east lake new technology development zone, wuhan

       Inquiry Now

  • CJC 1295 (2mg/vial) CAS NO.863288-34-0

  • Casno:

    863288-34-0

    MSDS/COA Download

    CJC 1295 (2mg/vial) CAS NO.863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-3.0/Kilogram

    Quick Details ProName: CJC 1295 (2mg/vial) CasNo: 863288-34-0 Molecular Formula: C152H252N44O42 Appearance: white Application: Bodybuilding DeliveryTime: 3-4 days PackAge: Disguised package Port: Hongkong Pr

    Hebei yanxi chemical co. LTD. has expanded a compositive entity from initially only as a small manufacturer. The company dedicated to the development, production and marketing of

  •  Hebei yanxi chemical co.,LTD.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-0311-66561638

    Address:Zhang zhe, guangzong county, xingtai city, hebei province

       Inquiry Now

  • CJC-1295 Acetate CAS NO.863288-34-0

  • Casno:

    863288-34-0

    CJC-1295 Acetate CAS NO.863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    Hubei Jusheng Technology Co., Ltd., is a global chemical industry manufacturers and suppliers of pharmaceuticals and intermediates in China. The yearly production capacity is 50000MT, 80% for export.We have a professinal export team. Both by Air a

    Hubei Jusheng Technology Co., Ltd., is a large group corporation which engaged in the R&D and manufacture of chemicals, Pharmaceuticals and intermediates. We have earned ourselves

  •  Hubei Jusheng Technology Co., Ltd.,

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-27-59599243

    Address:High-tech Industrial Park,Tianmen city,Hubei province.

       Inquiry Now

  • high quality  CJC1295  863288-34-0  to buy

  • Casno:

    863288-34-0

    high quality CJC1295 863288-34-0 to buy

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    With over 13 years experience online we offer a 100% delivery guarantee. If your parcels do not arrive in time we re-ship. If by some reasons you are not satisfied or you have any concerns, our hassle-free money back policy allows you to contact us

    Hubei Yuancheng Saichuang Technology Co., Ltd is a leading Chinese chemical supplier specialized in hormone steroid powders, Steroids injectable liquids, our company integrates R&D

  •  Hubei Yuancheng Saichuang Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-18872220686

    Address:Lunhe Road,Dongshan Tou Industrial Zone,Xiaogan,Hubei

       Inquiry Now

  • High quality CJC-1295 supplier in China

  • Casno:

    863288-34-0

    High quality CJC-1295 supplier in China

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our c

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

  •  Simagchem Corporation

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592-2680277

    Address:21/F Hualong Office Building,No.6 Hubin East Road, Xiamen,China

       Inquiry Now

  • Factory supply CJC-1295 Cas 863288-34-0 with DAC with high quality and favorable price

  • Casno:

    863288-34-0

    Factory supply CJC-1295 Cas 863288-34-0 with DAC with high quality and favorable price

    Min.Order: 1 Gram

    FOB Price:  USD $ 17000.0-17500.0/Gram

    Unique advantages for CJC-1295 Cas 863288-34-0 Guaranteed purity High quality & competitive price Quality control Fast feedback Prompt shipment Appearance:White powder Storage:N/A Package:2mg/vial,10vials/box Application:Medicine

    Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

  •  Wuhan Fortuna Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-59207852

    Address:A2705,Dong Yi Shi Qu,129# XinHua Road,WuHan,China

       Inquiry Now

  • Injection White Lyophilized Peptide Powder CJC-1295 without DAC

  • Casno:

    863288-34-0

    MSDS/COA Download

    Injection White Lyophilized Peptide Powder CJC-1295 without DAC

    Min.Order: 1 Gram

    FOB Price:  USD $ 3.0-3.0/Gram

    Dayangchem's R&D center can offer custom synthesis according to the contract research and development services for the fine chemicals, pharmaceutical, biotechnique and some of the other chemicals. DayangChem can provide different quantities

    Hangzhou Dayangchem Co.,Ltd dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(

  •  Hangzhou Dayangchem Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-88938639

    Address:9/F, Unit 2 Changdi Torch Building, 259# WenSan Road, Xihu District, Hangzhou City 310012, P.R.China

       Inquiry Now

  • CJC1295

  • Casno:

    863288-34-0

    CJC1295

    Min.Order: 100 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    CJC1295 Basic information

    Henan Sunlake Enterprise Corporation is located in Henan Province , the central plain of China , which enjoys favorable geogeaphical position and convenient transportion. The compa

  •  HENAN SUNLAKE ENTERPRISE CORPORATION

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-371- 55366292

    Address:No.110 HONGZHUAN ROAD, ZHENGZHOU,HENAN

       Inquiry Now

  • 98% Quality Protein Peptide Hormones 2Mg/vial White Cjc1295 Without Dac CAS 863288-34-0

  • Casno:

    863288-34-0

    98% Quality Protein Peptide Hormones 2Mg/vial White Cjc1295 Without Dac CAS 863288-34-0

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Our Adwantage: 1.We have stock so we can delivery quickly at the very day when receive the payment. 2.Best price, first class service, high successful delivery rate. A discount would be given when you make a large order. 3.High quality gua

    Hubei Xinrunde Chemical Co., Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(s)

  •  Hubei XinRunde Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-27-83214668

    Address:No.43, Xinandu Industrial Park, East and West Lake District, Wuhan, Hubei, China

       Inquiry Now

  • Global Sell Cjc-1295 Without Dac, Cjc1295 No Dac, CJC 1295

  • Casno:

    863288-34-0

    Global Sell Cjc-1295 Without Dac, Cjc1295 No Dac, CJC 1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 100.0-100.0/Kilogram

    Sincere recruitment of global agents, preferential conditions! whatsapp/wechat:+8615130202468 Sample for free! Crovell is specialized in pharmaceutical intermediates, veterinary drug intermediates and dyes intermediates,suc

    Thanks for your considering of Crovell Biotech (Hebei) Co., Ltd. Crovell is a fast growing intermediates company,Which located in Shijiazhuang,Hebei Province. Crovell is speciali

  •  Crovell Biotech (Hebei) Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+8619930501653

    Address:No.66, Yvhua West Road

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    MSDS/COA Download

    CJC-1295

    Min.Order: 10 Gram

    FOB Price:  USD $ 10.0-1000.0/Gram

    1) Quick Response Within 12 hours; 2) Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France etc. 3) OEM/ODM Available; 4) Reasonabl

    HUBEI AOKS BIO-TECH CO.,LTD is located in Hubei province of China.We specialized in Active pharmaceutical ingredient,pharmaceutical intermediates,veterinary drug intermediates and

  •  HUBEI AOKS BIO-TECH CO.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-27-52345788

    Address:28F,China Construction Third Bureau,Wuhan,Hubei Province, China

       Inquiry Now

  • cjc 1295 DAC Muscle Peptides bodybuilding cjc1295 with dac

  • Casno:

    863288-34-0

    cjc 1295 DAC Muscle Peptides bodybuilding cjc1295 with dac

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 25.0-35.0/Kilogram

    Product Description CJC-1295 is basically a peptide hormone that acts similar to growth hormone releasing hormones (GHRH). It achieves this by preventing degradation of its amino acids. With a single dose, it can remain in the body for quite a

    Tansen Yiang CO., LIMITED specializes in exporting high quality Research chemical,Basic chemical and so on. Our products are produced on the basis of best technical team, advanced

  •  Weifang Tansen Yiang international trading co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 17367738205

    Address:No.6700 Dongfeng West Street Weicheng District

       Inquiry Now

  • CJC-1295 NO DAC

  • Casno:

    863288-34-0

    CJC-1295 NO DAC

    Min.Order: 10 Milligram

    FOB Price:  USD $ 0.0-0.0/Milligram

    ProName:Peptides Bodybuilding cjc-1295 cjc 129... CasNo:863288-34-0 Molecular Formula:C152H252N44O42 Appearance:White powder Application:Growth Hormone Releasing Hormone DeliveryTime:2 days PackAge:CJC1295 Without DAC, 10

    Biochem-lab company has established a broad customer base in the Research Chemical and pharmaceutical industry in Russia, USA and European countries, and built close relationships

  •  biochem-lab.org

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-13265728306

    Address:Economic Development Zone,nanjing

       Inquiry Now

  • CJC1295 Without DAC manufacturer

  • Casno:

    863288-34-0

    MSDS/COA Download

    CJC1295 Without DAC manufacturer

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Our Advantages: 1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%. 2. Samples free trial: our company welcome samples to test our quality the

    Hangzhou Peptidego Biotech. Co.,Ltd is an internationally recognized biochemical manufacturing company which specialized in the production of peptide reagents, custom peptides and

  •  Hangzhou Peptidego Biotech Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0571-87213919

    Address:6-204,No.688,Bin'an road,Changhe street,BinJiang district,Hangzhou,Zhejiang,CN

       Inquiry Now

  • low price CJC-1295 CJC-1295  on hot sellingBest price 863288-34-0

  • Casno:

    863288-34-0

    MSDS/COA Download

    low price CJC-1295 CJC-1295 on hot sellingBest price 863288-34-0

    Min.Order: 2 Milligram

    FOB Price:  USD $ 660.0-790.0/Milligram

    Quality & Price 1. Factory price, reliable quality 2. Years produce and exporting experience 3. Strict quality control, free sample for test before order, keep sample after shipment for further issue Service 1. Enough stock, fas

    Wuhan Xinru Chemical Industry Co.,Ltd founded in 2006. It's an integrated chemical company involved in R&D, distribution and outsourcing. Taking the unique resource advantage of

  •  WUHAN XINRU CHEMICAL INDUSTRY CO.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-027-59843600

    Address:2805 ,Building 1,Fuxinghuiyu Fuxing City(North Area), Hejiadun Jianghan District

       Inquiry Now

  • CJC 1295

  • Casno:

    863288-34-0

    CJC 1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    Our Services 1. New Molecules R&D 2. Own test center HPLC NMR GC LC-MS 3. API and Intermediates from China reputed manufacturers 4. Documents support COA MOA MSDS DMF open part Our advantages 1. Government awarded company. Top 100 enter

    AFINE CHEMICALS LIMITED is specialized in the fine chemicals and pharmaceuticals and we have enjoyed great popularity in world markets. Since 2005, we have been rapidly growing to

  •  Afine Chemicals Limited

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-571-85134551

    Address:No. 206 Zhen Hua Road, Hangzhou 310030, Zhejiang, China

       Inquiry Now

  • Global Sell CJC-1295 Without Dac, CJC1295 No Dac, Cjc 1295

  • Casno:

    863288-34-0

    Global Sell CJC-1295 Without Dac, CJC1295 No Dac, Cjc 1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Sichuan Jisheng Biopharmaceutical Co.,Ltd is specializing of peptide and pharmaceutical intermediates. all of our products are produced in accordance with GMP standard and are exceeded in international quality standards. We are a leading peptide

    Our company is located in Deyang, a typical city of Sichuan - with beautiful scenery and mild climate. It occupies a total area of 16,000 square meters. We are a specialized manufa

  •  SICHUAN TONGSHENG AMINOACID CO.LTD

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-838-2274206

    Address:Room 1-11-1,No.19 of North TianShan Road,Deyang,Sichuan China

       Inquiry Now

  • High quality CJC-1295 DAC CJC-1295 no/without DAC

  • Casno:

    863288-34-0

    High quality CJC-1295 DAC CJC-1295 no/without DAC

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    1.high quality: quality is life. quality is the most important element for all goods. we have a lab doing research in wuhan china. hplc and nmr is available if needed. 2.reasonable price: we provide high quality products with competi

    Wuhan WONDA PHARMACEUTICAL AND CHEMICAL LIMITED is specializing in custom synthesis, manufacture and import & export of fine chemicals, APIs and pharmaceutical intermediates. WOND

  •  WUHAN WONDA PHARMACEUTICAL AND CHEMICAL LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:18186124209

    Address:Wuhan Private Science and Technology Park , Wuhan, China

       Inquiry Now

  • Top Quality Peptide Powder CJC-1295 (Without DAC)

  • Casno:

    863288-34-0

    Top Quality Peptide Powder CJC-1295 (Without DAC)

    Min.Order: 1 Gram

    FOB Price:  USD $ 5.0-10.0/Gram

    Strong backup of facotry: high R&D ability, favorable quality and competitive price 2. Stock avaliability 3. Flexible business way, like payment term and product delivery 4. Fast response 24*7 5. A good troubleshooter/very positive atti

    Beijing Yibai Biotechnology Co., Ltd, backed up with factory toppest support with high R&D ability, we have confidence to make you more competitive on market. Yibai is devoting fo

  •  Beijing Yibai Biotechnology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-010-60404860

    Address:Xuhui Plaza, Shunyi district, Beijing

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    CJC-1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 100.0-100.0/Kilogram

    HangYu Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. HangYu Chemical consis

    Zibo HangYu Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals

  •  Zibo Hangyu Import&Export Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15988566987

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • CJC-1295 DAC CAS NO.863288-34-0

  • Casno:

    863288-34-0

    CJC-1295 DAC CAS NO.863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    1.High quality and competetive price 1)for prulifloxacin exported we can offer coa certificate and official invoice. 2)we are manufacturer with own lab and factory, can provide high quality products with factory price. 3)products purity is tes

    Wuhan New-Rise biochem Co.,Ltd. is a leading provider and manufacturer of pharmaceutical and chemical products. We are dedicated in providing a wide variety of quality API, pharm

  •  Wuhan New-Rise Biochem Co,. Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-13667132959

    Address:Wuhan

       Inquiry Now

  • Manufacturer of Peptide Human Growth Cjc1295 for Muscle Enhance

  • Casno:

    863288-34-0

    Manufacturer of Peptide Human Growth Cjc1295 for Muscle Enhance

    Min.Order: 10 Metric Ton

    FOB Price:  USD $ 10.0-30.0/Metric Ton

    Superiority 1.As a professional production leading factory & lab in China in pharmaceutical area of 15 years, our market to USA, Australia, Middle East, Germany, Spain, UK, and so on other country. What’s more, good feedback from ou

    Filter Biotechnology Co., Ltd is a High-Tech Bio-Chemical Enterprise which is integrated by Professional Scientific R&D, Mass production and Sales. As a world-leading Provider

  •  Zhengzhou Filter Biotechnology Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0086-18503829707

    Address:South of Nongye Rd. Zhengdong New District,Zhengzhou

       Inquiry Now

  • CJC-1295 Acetate without DAC

  • Casno:

    863288-34-0

    CJC-1295 Acetate without DAC

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    high quality & timely delivery Storage:MSDS reference Package:Bag/Bottle/Drum Application:organic and speciality chemicals Transportation:by courier/air/sea Port:Shanghai

    Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

  •  Health Chemicals Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-512-58277800

    Address:No. 338, Jingang Avenue,

       Inquiry Now

  • CJC 1295

  • Casno:

    863288-34-0

    CJC 1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Superior quality, moderate price & quick delivery. Appearance:White Lyophilized Powder Storage:Stored in cool, dry and ventilation place; Away from fire and heat Package:1kg/bag, 1kg/drum or 25kg/drum or as per your request. Application:Used as

    Hangzhou Yunuo Chemical Co., Ltd. is located in Hangzhou City, China We are specialized in fine chemicals and basic chemical auxiliary materials, Organic compounds, rubber

  •  HANGZHOU YUNUO CHEMICAL CO.,LTD

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0571-83715115

    Address:hangzhou

       Inquiry Now

  • Cjc-1295 2mg/vial CJC-1295 cjc1295 CJC1295

  • Casno:

    863288-34-0

    MSDS/COA Download

    Cjc-1295 2mg/vial CJC-1295 cjc1295 CJC1295

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Appearance: White Lyophilized Powder Application: bodybuilding, Muscle growth ,Therapeut... DeliveryTime: within a week PackAge: Discreet packing ways as your requirem... Port: shenzhen hongkong

    Guangzhou XinKe Chemical Co., LTD is a leading Chinese chemical supplier specialized in hormone steroid powders, Steroids injectable liquids, our company integrates R&D, producing,

  •  Guangzhou XinKe Chemical Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15608862702

    Address:guangzhou

       Inquiry Now

  • TIANFUCHEM--CJC1295

  • Casno:

    863288-34-0

    TIANFUCHEM--CJC1295

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 20.0-20.0/Metric Ton

    Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl

    Our company engages in Electronic chemicals such as OLED,Photoresist chemical,Electrolyte additive and Intermediate Pharmaceutical production; development of noble metal catalysts,

  •  Henan Tianfu Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • CJC1295

  • Casno:

    863288-34-0

    CJC1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.9-1.0/Kilogram

    LIDE PHARMACEUTICALS LIMITED is a professional chemicals and APIs leading manufacturer in China. Our core business line covers APIs, Intermediates, Herb extract, etc.

    LIDE PHARMACEUTICALS LIMITED is one of the fastest growing pharmaceutical company in China. We have developed strategic partnership with our manufacturing associates having state o

  •  LIDE PHARMACEUTICALS LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-25-58766653

    Address:11F, Building A1, No.288 North Zhongshan Road, Gulou District, Nanjing,210003, P.R.China.

       Inquiry Now

  • CJC 1295

  • Casno:

    863288-34-0

    CJC 1295

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Located in Hangzhou National Hi-Tech Industrial Development Zone, zhongqichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various industries. Benefiting from the outstanding customer service and h

    Located in Hangzhou National Hi-Tech Industrial Development Zone, Hangzhou zhongqichem co.,Ltd is an ISO 9001:2015 & SGS certified molden chemical company,who is mainly focus on th

  •  Hangzhou Zhongqichem Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:0086-571-86976032

    Address:Keji Guan jie 1505 ,Binjiang District 310052 ,Hangzhou city ,China

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    CJC-1295

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of Agricultural Sciences, Institute of Ecological Science Park, Beijing

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of

  •  wuxi leji biology technology co., LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:13771368689

    Address:The Nanyue Road No. 2, Yixing City, Jiangsu Province

       Inquiry Now

Please post your buying leads,so that our qualified suppliers will soon contact you!
*Required Fields

    Premium Related Products