Welcome to LookChem.com Sign In|Join Free
  • or
Home > Products > 863288 > 

863288-34-0

Basic Information
CAS No.: 863288-34-0
Name: CJC 1295
Molecular Structure:
Molecular Structure of 863288-34-0 (CJC 1295)
Formula: C159H258N46O45
Molecular Weight: 3534.03
Synonyms: CJC-1295;
EINECS:
Density:
Melting Point:
Boiling Point:
Flash Point:
Solubility:
Appearance: White Lyophilized Powder
Hazard Symbols:
Risk Codes:
Safety:
Transport Information:
  • Display:default sort

    New supplier

  • CJC1295 With DAC

  • Casno:

    863288-34-0

    MSDS/COA Download

    CJC1295 With DAC

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0/Gram

    Best Quality Competitive Price Fast&Safe Delivery Perfect Services We are professional in APIs, pharmaceutical intermediates, plant extracts, fine chemicals, Lab equipment and so on. A price lower than that offered by the

    Egbert Corporation is one of the biggest manufacturers and exporters of chemical raw materials in China. We are professional in APIs, pharmaceutical intermediates, plant extracts,

  •  EGBERT CORPORATION

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-532-80913291

    Address:No.6 Qingshan Road,Licang District

       Inquiry Now

  • CJC 1295 Anti Aging Peptides CJC-1295 With DAC for Bodybuilding Supplements

  • Casno:

    863288-34-0

    CJC 1295 Anti Aging Peptides CJC-1295 With DAC for Bodybuilding Supplements

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    1) Our company is a professional raw powder factory in China for over 16 years, all powders are factory directly supplying. 2) Our products have exported to Germany, Norway, Poland, Finland, Spain, UK, France, Russia, USA, Australia, Japan, Kore

    Tai'an Jia Ye Biological Technology Co.,Ltd is a comprehensive and high-tech enterprise special in pharmaceutical intermediate,Integrating R & D, Manufacturing, Operating and Marke

  •  Tai'an Jia Ye Biological Technology Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-0538-6309826

    Address:Great Wall Road 6, Tai'an City,Shandong Province,China

       Inquiry Now

  • CJC-1295 with DAC 2mg/vial Peptides for bodybuilding

  • Casno:

    863288-34-0

    CJC-1295 with DAC 2mg/vial Peptides for bodybuilding

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    Rich experience. We have specialized in this field for 7 years. Our steroids and hormones have been exported to overseas, like Europe, Africa, Asia, America and other countries. And we have got very good feedback from our customers, and establ

    Hubei God bull Pharmaceutical Co.,Ltd is a leading pharmaceutical and plant extract factory which is special in steroid powder and pahrmaceutical intermediate,plant extract. .Acco

  •  Hubei God bull Pharmaceutical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-027-52341258

    Address:No.58, guanggu avenue, east lake new technology development zone, wuhan

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    CJC-1295

    Min.Order: 10 Gram

    FOB Price:  USD $ 1.0-5.0/Gram

    Our advantages: 1.High quality and competetive price 1)For Add (CJC-1295) exported we can offer COA Certificate. 2)We are manufacturer with own lab and factory, can provide high quality products with factory price. 3)Products purity is test

    Shenzhen Sendi Biotechnology Co.Ltd is a comprehensive and high-tech enterprise special in chemical synthetic drug, pharmaceutical intermediates, Chemical raw materials, chemical a

  •  SHENZHEN SENDI BIOTECHNOLOGY CO.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-0755-23707617

    Address:306# Xinsha Road

       Inquiry Now

  • Hot Sale Cjc-1295 for Bodybuilding with GMP SGS (with DAS)

  • Casno:

    863288-34-0

    Hot Sale Cjc-1295 for Bodybuilding with GMP SGS (with DAS)

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    1) Rich experience We specialize in this field for many years,our pharmaceutical raw materials exported to Overseas, to Europe,Africa,Asia, Americas and other country, and we have got very good feedback from our customers ,and Establis

    Wuhan Disel Biotechnoloy?Co., Ltd. (shorted as Disel Biotech)?is located in Wuhan Donghu High-Tech Economic Development Zone, Wuhan is a big central city in China with?convenient t

  •  Wuhan Disel Biotechnology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-27-87001826

    Address:No.6 Fozuling 3rd Road, East Lake High-tech Development Zone, Wuhan City, Hubei Province, China 430000

       Inquiry Now

  • CJC-1295 Acetate CAS NO.863288-34-0

  • Casno:

    863288-34-0

    CJC-1295 Acetate CAS NO.863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    Hubei Jusheng Technology Co., Ltd., is a global chemical industry manufacturers and suppliers of pharmaceuticals and intermediates in China. The yearly production capacity is 50000MT, 80% for export.We have a professinal export team. Both by Air a

    Hubei Jusheng Technology Co., Ltd., is a large group corporation which engaged in the R&D and manufacture of chemicals, Pharmaceuticals and intermediates. We have earned ourselves

  •  Hubei Jusheng Technology Co., Ltd.,

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-27-59599243

    Address:High-tech Industrial Park,Tianmen city,Hubei province.

       Inquiry Now

  • CJC-1295 DAC 2mg/vial 5mg/vial Purchase Peptides

  • Casno:

    863288-34-0

    CJC-1295 DAC 2mg/vial 5mg/vial Purchase Peptides

    Min.Order: 10 Kilogram

    FOB Price:  USD $ 1.0-1.0/Kilogram

    Packaging & Delivery: 1. Sufficient stock. We can delivery promptly at the very day when receive the payment 2. Sophisticated and professional logistic agent. We take responsibility to provide our customers with fast delivery and secure shi

    Our company is a comprehensive and high-tech enterprise specializing in pharmaceutical intermediates. Our boss grows the company through sound management and innovative strategies

  •  Wuhan Yuancheng Gongchuang Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-18829962075

    Address:No. 201, Qianjia Street, Wuchang District, Wuhan City, Hubei Province, China

       Inquiry Now

  • high quality  CJC1295  863288-34-0  to buy

  • Casno:

    863288-34-0

    high quality CJC1295 863288-34-0 to buy

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    With over 13 years experience online we offer a 100% delivery guarantee. If your parcels do not arrive in time we re-ship. If by some reasons you are not satisfied or you have any concerns, our hassle-free money back policy allows you to contact us

    Hubei Yuancheng Saichuang Technology Co., Ltd is a leading Chinese chemical supplier specialized in hormone steroid powders, Steroids injectable liquids, our company integrates R&D

  •  Hubei Yuancheng Saichuang Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-18872220686

    Address:Lunhe Road,Dongshan Tou Industrial Zone,Xiaogan,Hubei

       Inquiry Now

  • High quality CJC-1295 supplier in China

  • Casno:

    863288-34-0

    High quality CJC-1295 supplier in China

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our c

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

  •  Simagchem Corporation

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592-2680277

    Address:21/F Hualong Office Building,No.6 Hubin East Road, Xiamen,China

       Inquiry Now

  • Injection White Lyophilized Peptide Powder CJC-1295 without DAC

  • Casno:

    863288-34-0

    MSDS/COA Download

    Injection White Lyophilized Peptide Powder CJC-1295 without DAC

    Min.Order: 1 Gram

    FOB Price:  USD $ 3.0-3.0/Gram

    Dayangchem's R&D center can offer custom synthesis according to the contract research and development services for the fine chemicals, pharmaceutical, biotechnique and some of the other chemicals. DayangChem can provide different quantities

    Hangzhou Dayangchem Co.,Ltd dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(

  •  Hangzhou Dayangchem Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-88938639

    Address:9/F, Unit 2 Changdi Torch Building, 259# WenSan Road, Xihu District, Hangzhou City 310012, P.R.China

       Inquiry Now

  • CJC 1295 (2mg/vial) CAS NO.863288-34-0

  • Casno:

    863288-34-0

    MSDS/COA Download

    CJC 1295 (2mg/vial) CAS NO.863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-3.0/Kilogram

    Quick Details ProName: CJC 1295 (2mg/vial) CasNo: 863288-34-0 Molecular Formula: C152H252N44O42 Appearance: white Application: Bodybuilding DeliveryTime: 3-4 days PackAge: Disguised package Port: Hongkong Pr

    Hebei yanxi chemical co., LTD is a professional research, development and production lead diacetate trihydrate /Lead acetate trihydrateCAS:6080-56-4 2-phenylacetamide CAS:103

  •  Hebei yanxi chemical co.,LTD.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15631172802

    Address:Zhang zhe, guangzong county, xingtai city, hebei province

       Inquiry Now

  • 98% Quality Protein Peptide Hormones 2Mg/vial White Cjc1295 Without Dac CAS 863288-34-0

  • Casno:

    863288-34-0

    98% Quality Protein Peptide Hormones 2Mg/vial White Cjc1295 Without Dac CAS 863288-34-0

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Our Adwantage: 1.We have stock so we can delivery quickly at the very day when receive the payment. 2.Best price, first class service, high successful delivery rate. A discount would be given when you make a large order. 3.High quality gua

    Hubei Xinrunde Chemical Co., Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(s)

  •  Hubei XinRunde Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-27-83214668

    Address:No.43, Xinandu Industrial Park, East and West Lake District, Wuhan, Hubei, China

       Inquiry Now

  • CJC1295

  • Casno:

    863288-34-0

    CJC1295

    Min.Order: 100 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    CJC1295 Basic information

    Henan Sunlake Enterprise Corporation is located in Henan Province , the central plain of China , which enjoys favorable geogeaphical position and convenient transportion. The compa

  •  HENAN SUNLAKE ENTERPRISE CORPORATION

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-371-86562286

    Address:No.110 HONGZHUAN ROAD, ZHENGZHOU,HENAN

       Inquiry Now

  • High Purity Fat Burning Cjc-1295 Peptide

  • Casno:

    863288-34-0

    High Purity Fat Burning Cjc-1295 Peptide

    Min.Order: 10 Gram

    FOB Price:  USD $ 120.0-120.0/Gram

    Our Advantages: 1). delivery:within 24 hour deliver after payment usaually . 2). price and quality :much lower price than the market price with same quality.and each goods is elite,we just send best quality goods. 3). best after sale servic

    Linyi dingsheng chemical Co., Ltd is located in Shandong province, China, which specialized in chemicals such as research chemical ,pharmaceutical intermediates and other fine chem

  •  Linyi dingsheng chemical products Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-539-5320425

    Address:guazhou Road,Linyi City, Shandong, China

       Inquiry Now

  • CJC1295 without DAC

  • Casno:

    863288-34-0

    CJC1295 without DAC

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.5/Gram

    We promise our customer following items 1.Reasonable price: We provide high quality products with competitive price in China, 2.Low MOQ: No worry about the low MOQ, our MOQ is 1 gram or lower. 3.Good and efficient Service, G

    Company Introduction Founded in 1996, Baowei Technology Group is specialized in the R&D, designing, manufacturing in series of the new high- tech chemical materials and related pro

  •  Baowei Technology Qinhuangdao Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-335-8505079

    Address:No4, Oak Bay,Haigang District

       Inquiry Now

  • CJC1295 Cjc-1295 Without Dac 863288-34-0

  • Casno:

    863288-34-0

    CJC1295 Cjc-1295 Without Dac 863288-34-0

    Min.Order: 10 Gram

    FOB Price:  USD $ 2.0-2.0/Gram

    Advantage of Our Company (1)Fast discreet delivery with great shipping success! (2)Pictures with your order & details! (3)We will provide you the tracking number! (4)Keep track of your goods untill the goods are sent in to your hand

    We, Shanghai ShuCan Industrial Co.,Ltd, is one of the leading manufacturers, exporters, suppliers &traders of high quality Testosterone Enanthate, Testosterone Steroids, Steroids P

  •  Shanghai ShuCan Industrial Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-17301859715

    Address:Room 1301, No. 28, 19 North Fisheries Road, Changning District,Shanghai,China

       Inquiry Now

  • Factory supply Peptide CAS NO. 863288-34-0 CJC 1295 DAC

  • Casno:

    863288-34-0

    Factory supply Peptide CAS NO. 863288-34-0 CJC 1295 DAC

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Factory supply Peptide CAS NO. 863288-34-0 CJC 1295 DAC 1.Professional manufaucture and supplier 2.High purity 3.Lowest price 4.Powerful and professional forwarder Appearance:White powder Storage:Stored in the dry and ventilated inside stor

    ZhiShang Chemical is owned by ZhiShang Group, is a professional new-type chemicals enterprise combined into research and development, production and sales . The company's competit

  •  Shandong Zhi Shang Chemical Co.Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-531-67805312

    Address:Diao Town Industry Park, Zhangqiu City, Jinan City, Shandong Province, China.

       Inquiry Now

  • CJC-1295 Acetate CAS NO.863288-34-0

  • Casno:

    863288-34-0

    MSDS/COA Download

    CJC-1295 Acetate CAS NO.863288-34-0

    Min.Order: 5 Kiloliter

    FOB Price:  USD $ 0.8-1.0/Kiloliter

    High quality, best service,competitive price are our principle Our strength We have clients throughout the world: Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet y

    Hebei chongbao biological technology co., LTD is a high technology researching company focusing on the health and medicine business of creating better life for people. we mainly p

  •  Hebei chongbao biological technology co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-0311-83975171

    Address:Dacheng

       Inquiry Now

  • CJC-1295 Acetate without DAC 863288-34-0

  • Casno:

    863288-34-0

    CJC-1295 Acetate without DAC 863288-34-0

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    1.High quality : the purity is 99% min . through multiple producing procedures. 2.Competitive price : low price because of our skilled production technolpgy ,save the production cost at most , and give big profit room to our customers

    Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

  •  Wuhan Fortuna Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-59207850

    Address:A2705,Dong Yi Shi Qu,129# XinHua Road,WuHan,China

       Inquiry Now

  • Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production

  • Casno:

    863288-34-0

    Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Run-Biotech provides a broad and integrated portfolio of services throughout the drug R&D process. Our services are designed to help our worldwide customers shorten the discovery and development time and lower the cost of drug and medical devic

    Dine products include organic reagents, inorganic reagents and biochemical reagents, including pharmaceutical intermediates, bulk drugs, catalysts, high purity solvents, specialty

  •  Shanghai Run-Biotech Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-21-57171705 / 57171706

    Address:No.787, Kangqiao Road, Pudong New District, Shanghai, China

       Inquiry Now

  • Mgf /Mechano Growth Factor Purchase Peptides For increase muscle mass

  • Casno:

    863288-34-0

    Mgf /Mechano Growth Factor Purchase Peptides For increase muscle mass

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0/Gram

    1, High quality with competitive price: 1)Purity≥ 99% 2)We are manufacturer and can provide high quality products with factory price,offering free samples to test, a few shipping fee only. 2.Flexible Payment term

    Wuhan Honor Bio-Pharm Co., Ltd. is located at Wuhan, Hubei province of China. It is a high-tech enterprise professionally has been devoting itself in research, development and sale

  •  Wuhan Honor Bio-Pharm Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0086-027-88042901

    Address:Suite 1420, No.9 Building, Wanda Plaza, No.209 Heping Avenue, Wuchang District, Wuhan City, Hubei Province, P.R.China

       Inquiry Now

  • igf-1 hot sale CAS NO.863288-34-0

  • Casno:

    863288-34-0

    igf-1 hot sale CAS NO.863288-34-0

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    hebei qiute trade co.,ltd is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including Intermediates & API, Catalyst, Electro

    Hebei qiute trade co.,ltd is a leading supplier of fine chemical in China, is located in hebei. The unique geographical conditions of hebei are favorable for transportation. The co

  •  hebei qiute trade co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:17081281057

    Address:qiaodongqu

       Inquiry Now

  • Global Sell CJC-1295 Without Dac, CJC1295 No Dac, Cjc 1295

  • Casno:

    863288-34-0

    Global Sell CJC-1295 Without Dac, CJC1295 No Dac, Cjc 1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Sichuan Jisheng Biopharmaceutical Co.,Ltd is specializing of peptide and pharmaceutical intermediates. all of our products are produced in accordance with GMP standard and are exceeded in international quality standards. We are a leading peptide

    Our company is located in Deyang, a typical city of Sichuan - with beautiful scenery and mild climate. It occupies a total area of 16,000 square meters. We are a specialized manufa

  •  SICHUAN TONGSHENG AMINOACID CO.LTD

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-838-2274206

    Address:Room 1-11-1,No.19 of North TianShan Road,Deyang,Sichuan China

       Inquiry Now

  • Global Sell Cjc-1295 Without Dac, Cjc1295 No Dac, CJC 1295

  • Casno:

    863288-34-0

    Global Sell Cjc-1295 Without Dac, Cjc1295 No Dac, CJC 1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 100.0-100.0/Kilogram

    Sincere recruitment of global agents, preferential conditions! whatsapp/wechat:+8615130202468 Sample for free! Crovell is specialized in pharmaceutical intermediates, veterinary drug intermediates and dyes intermediates,suc

    Thanks for your considering of Crovell Biotech (Hebei) Co., Ltd. Crovell is a fast growing intermediates company,Which located in Shijiazhuang,Hebei Province. Crovell is speciali

  •  Crovell Biotech (Hebei) Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-0311-66562153

    Address:No.66 Yuhua West Road,Qiaoxi District,Shijiazhuang,China

       Inquiry Now

  • CJC1295 Without DAC manufacturer

  • Casno:

    863288-34-0

    MSDS/COA Download

    CJC1295 Without DAC manufacturer

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Our Advantages: 1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%. 2. Samples free trial: our company welcome samples to test our quality the

    Hangzhou Peptidego Biotech. Co.,Ltd is an internationally recognized biochemical manufacturing company which specialized in the production of peptide reagents, custom peptides and

  •  Hangzhou Peptidego Biotech Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0571-87213919

    Address:Building 6,Tianhe Hi-Tech park, Binjiang district, Hangzhou, Zhejiang , China

       Inquiry Now

  • Pepides CJC1295dac with 2mg/vial

  • Casno:

    863288-34-0

    MSDS/COA Download

    Pepides CJC1295dac with 2mg/vial

    Min.Order: 10 Gram

    FOB Price:  USD $ 3.0-5.0/Gram

    About Our Company This is Grace from Zhengzhou Filter Biotechnology Co.,Ltd.We are the professional supplier of peptide products in China over 10 years. we have Professional Lab to confirm the Quality and Serive for all clients in long-term run

    Filter Biotechnology Co., Ltd is a High-Tech Bio-Chemical Enterprise which is integrated by Professional Scientific R&D, Mass production and Sales. As a world-leading Provider

  •  Zhengzhou Filter Biotechnology Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0086-18503829707

    Address:South of Nongye Rd. Zhengdong New District,Zhengzhou

       Inquiry Now

  • Global sale CJC-1295 Without Dac, CJC1295 No Dac, CJC 1295

  • Casno:

    863288-34-0

    Global sale CJC-1295 Without Dac, CJC1295 No Dac, CJC 1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    1.High Quality: Quality is life. Quality is the most important element for all goods. We have a lab doing research in Wuhan China and produce sarms in bulk quantity. We have 8 years experience making all kinds of sarms. And all our old customers

    HK WONDA PHARMACEUTICAL AND CHEMICAL LIMITED is specializing in custom synthesis, manufacture and import & export of fine chemicals, APIs and pharmaceutical intermediates. WONDA P

  •  HK WONDA PHARMACEUTICAL AND CHEMICAL LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-18186124209

    Address:FLAT 1506.145/F LUCKY CTR NO 165-171 WAN CHAI RD WAN CHAI

       Inquiry Now

  • CJC-1295 Acetate without DAC

  • Casno:

    863288-34-0

    CJC-1295 Acetate without DAC

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    high quality & timely delivery Storage:MSDS reference Package:Bag/Bottle/Drum Application:organic and speciality chemicals Transportation:by courier/air/sea Port:Shanghai

    Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

  •  Health Chemicals Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-512-58277800

    Address:No. 338, Jingang Avenue,

       Inquiry Now

  • CJC 1295

  • Casno:

    863288-34-0

    CJC 1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Superior quality, moderate price & quick delivery. Appearance:White Lyophilized Powder Storage:Stored in cool, dry and ventilation place; Away from fire and heat Package:1kg/bag, 1kg/drum or 25kg/drum or as per your request. Application:Used as

    Hangzhou Yunuo Chemical Co., Ltd. is located in Hangzhou City, China We are specialized in fine chemicals and basic chemical auxiliary materials, Organic compounds, rubber

  •  HANGZHOU YUNUO CHEMICAL CO.,LTD

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0571-83715115

    Address:hangzhou

       Inquiry Now

  • Cjc-1295 2mg/vial CJC-1295 cjc1295 CJC1295

  • Casno:

    863288-34-0

    MSDS/COA Download

    Cjc-1295 2mg/vial CJC-1295 cjc1295 CJC1295

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Appearance: White Lyophilized Powder Application: bodybuilding, Muscle growth ,Therapeut... DeliveryTime: within a week PackAge: Discreet packing ways as your requirem... Port: shenzhen hongkong

    Guangzhou XinKe Chemical Co., LTD is a leading Chinese chemical supplier specialized in hormone steroid powders, Steroids injectable liquids, our company integrates R&D, producing,

  •  Guangzhou XinKe Chemical Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15608862702

    Address:guangzhou

       Inquiry Now

  • TIANFUCHEM--CJC1295

  • Casno:

    863288-34-0

    TIANFUCHEM--CJC1295

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 20.0-20.0/Metric Ton

    Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl

    Our company engages in Electronic chemicals such as OLED,Photoresist chemical,Electrolyte additive and Intermediate Pharmaceutical production; development of noble metal catalysts,

  •  Henan Tianfu Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • CJC1295

  • Casno:

    863288-34-0

    CJC1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.9-1.0/Kilogram

    LIDE PHARMACEUTICALS LIMITED is a professional chemicals and APIs leading manufacturer in China. Our core business line covers APIs, Intermediates, Herb extract, etc.

    LIDE PHARMACEUTICALS LIMITED is one of the fastest growing pharmaceutical company in China. We have developed strategic partnership with our manufacturing associates having state o

  •  LIDE PHARMACEUTICALS LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-25-58766653

    Address:11F, Building A1, No.288 North Zhongshan Road, Gulou District, Nanjing,210003, P.R.China.

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    CJC-1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 10.0-10.0/Gram

    Zhejiang J&C Biological Technology Co., Limited is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including Intermediates &a

    ZHEJIANG BIOLOGY AND TECHNOLOGY CO., LTD. is a modern professional high-tech enterprise, which is specializing in generic APIs and pharmaceutical intermediates. especially in pepti

  •  Zhejiang J&C Biological Technology Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15857007529

    Address:46# zhongshan road, quzhou zhejiang

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    CJC-1295

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    ProName: CJC-1295 DAC 2mg/vial 5mg/vial Purchas... CasNo: 863288-34-0 Molecular Formula: C165H269N47O46 Appearance: White Crystalline Powder Application: CJC-1295 DAC has shown some amazing re... DeliveryTime: 3-7 days Pa

    With 30 years experience in import and export trade, we have been praised as "Focal enterprise for earning foreign exchange in Taizhou", "Advanced export enterprise in Taizhou" and

  •  Xinming International Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-576-86123635

    Address:15/F.General Chamber of Commerce Bldg.,No.159 Henghu Road M.,Wenling,Zhejiang,China.

       Inquiry Now

  • CJC 1295

  • Casno:

    863288-34-0

    CJC 1295

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Appearance:Solid powder Storage:Sealed,light and oxygen resistant Package:Foil bag or drum Application:Applied in dietary supplements,pharmaceutical or cosmeticeuticals Transportation:by sea or air Port:Beijing or Guangzhou Port

    Kono Chem Co.,Ltd is a leading producer of standardized herbal extracts, natural active ingredients and APIs for pharmaceutical, health food and cosmetic industries. Annually, mo

  •  Kono Chem Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-29-86107037-8015

    Address:No.11 Daqing Road,Lianhu District,Xi’an 710082,China

       Inquiry Now

  • CJC1295 with high quality 95% and good price

  • Casno:

    863288-34-0

    CJC1295 with high quality 95% and good price

    Min.Order: 1 Gram

    FOB Price:  USD $ 10.0-10.0/Gram

    CJC1295(GHRH/DAC) 863288-34-0 Sterile Filtered White lyophilized (freeze-dried) powder Storage : 2~8℃,protected from light Long-term Storage: -20 ± 5 °C Purity>95% Enterprise standard Appearance:Sterile Filtered Whit

    Fond Ever Co.,Limited is a high-tech enterprise specialized in the research manufacture and trade of the APIs, pharmaceutical intermediates and bio-chemicals.We will pursue quality

  •  FOND EVER CO.,LIMITED

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-18357120975

    Address:No.30,Wuzhou Road

       Inquiry Now

Please post your buying leads,so that our qualified suppliers will soon contact you!
*Required Fields

    Premium Related Products