863288-34-0

Casno:

863288-34-0

MSDS/COA Download

CJC1295 With DAC

Min.Order: 1 Gram

FOB Price:  USD $ 1.0-1.0/Gram

Best Quality Competitive Price Fast&Safe Delivery Perfect Services We are professional in APIs, pharmaceutical intermediates, plant extracts, fine chemicals, Lab equipment and so on. A price lower than that offered by the

Egbert Corporation is one of the biggest manufacturers and exporters of chemical raw materials in China. We are professional in APIs, pharmaceutical intermediates, plant extracts,

CJC 1295 Anti Aging Peptides CJC-1295 With DAC for Bodybuilding Supplements

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0/Gram

1) Our company is a professional raw powder factory in China for over 16 years, all powders are factory directly supplying. 2) Our products have exported to Germany, Norway, Poland, Finland, Spain, UK, France, Russia, USA, Australia, Japan, Kore

Tai'an Jia Ye Biological Technology Co.,Ltd is a comprehensive and high-tech enterprise special in pharmaceutical intermediate,Integrating R & D, Manufacturing, Operating and Marke

CJC-1295 with DAC 2mg/vial Peptides for bodybuilding

Min.Order: 0 Metric Ton

FOB Price:  USD $ 0.0-0.0/Metric Ton

Rich experience. We have specialized in this field for 7 years. Our steroids and hormones have been exported to overseas, like Europe, Africa, Asia, America and other countries. And we have got very good feedback from our customers, and establ

Hubei God bull Pharmaceutical Co.,Ltd is a leading pharmaceutical and plant extract factory which is special in steroid powder and pahrmaceutical intermediate,plant extract. .Acco

CJC-1295

Min.Order: 10 Gram

FOB Price:  USD $ 1.0-5.0/Gram

Our advantages: 1.High quality and competetive price 1)For Add (CJC-1295) exported we can offer COA Certificate. 2)We are manufacturer with own lab and factory, can provide high quality products with factory price. 3)Products purity is test

Shenzhen Sendi Biotechnology Co.Ltd is a comprehensive and high-tech enterprise special in chemical synthetic drug, pharmaceutical intermediates, Chemical raw materials, chemical a

Casno:

863288-34-0

MSDS/COA Download

CJC-1295 without DAC (CJC-1293) Pharmaceutical Peptide CAS 863288-34-0 2mg/Vial Legal Lyophilized Polypeptide

Min.Order: 10 Gram

FOB Price:  USD $ 10.0-1000.0/Gram

Quick Detail: Products Name: CJC-1295 Alias: CJC-1295 Acetate; CJC1295(Without DAC); Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-VAL-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimid

Shenzhen Sendi Biotechnology Co.,Ltd. Located in the revolutionary pioneering city Shenzhen, Shenzhen Sendi Biotechnology Co.,Ltd. is a top supplier of fine chemicals, Our main pro

Hot Sale Cjc-1295 for Bodybuilding with GMP SGS (with DAS)

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0/Gram

1) Rich experience We specialize in this field for many years,our pharmaceutical raw materials exported to Overseas, to Europe,Africa,Asia, Americas and other country, and we have got very good feedback from our customers ,and Establis

Wuhan Disel Biotechnoloy?Co., Ltd. (shorted as Disel Biotech)?is located in Wuhan Donghu High-Tech Economic Development Zone, Wuhan is a big central city in China with?convenient t

CJC-1295 Acetate CAS NO.863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.0-0.0/Kilogram

Hubei Jusheng Technology Co., Ltd., is a global chemical industry manufacturers and suppliers of pharmaceuticals and intermediates in China. The yearly production capacity is 50000MT, 80% for export.We have a professinal export team. Both by Air a

Hubei Jusheng Technology Co., Ltd., is a large group corporation which engaged in the R&D and manufacture of chemicals, Pharmaceuticals and intermediates. We have earned ourselves

CJC-1295 DAC 2mg/vial 5mg/vial Purchase Peptides

Min.Order: 10 Kilogram

FOB Price:  USD $ 1.0-1.0/Kilogram

Packaging & Delivery: 1. Sufficient stock. We can delivery promptly at the very day when receive the payment 2. Sophisticated and professional logistic agent. We take responsibility to provide our customers with fast delivery and secure shi

Our company is a comprehensive and high-tech enterprise specializing in pharmaceutical intermediates. Our boss grows the company through sound management and innovative strategies

high quality CJC1295 863288-34-0 to buy

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

With over 13 years experience online we offer a 100% delivery guarantee. If your parcels do not arrive in time we re-ship. If by some reasons you are not satisfied or you have any concerns, our hassle-free money back policy allows you to contact us

Hubei Yuancheng Saichuang Technology Co., Ltd is a leading Chinese chemical supplier specialized in hormone steroid powders, Steroids injectable liquids, our company integrates R&D

High quality CJC-1295 supplier in China

Min.Order: 0

FOB Price:  USD $ 0.0-0.0/

Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our c

Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

Casno:

863288-34-0

MSDS/COA Download

Injection White Lyophilized Peptide Powder CJC-1295 without DAC

Min.Order: 1 Gram

FOB Price:  USD $ 3.0-3.0/Gram

Dayangchem's R&D center can offer custom synthesis according to the contract research and development services for the fine chemicals, pharmaceutical, biotechnique and some of the other chemicals. DayangChem can provide different quantities

Hangzhou Dayangchem Co.,Ltd dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(

Casno:

863288-34-0

MSDS/COA Download

CJC 1295 (2mg/vial) CAS NO.863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 1.0-3.0/Kilogram

Quick Details ProName: CJC 1295 (2mg/vial) CasNo: 863288-34-0 Molecular Formula: C152H252N44O42 Appearance: white Application: Bodybuilding DeliveryTime: 3-4 days PackAge: Disguised package Port: Hongkong Pr

Hebei yanxi chemical co., LTD is a professional research, development and production lead diacetate trihydrate /Lead acetate trihydrateCAS：6080-56-4 2-phenylacetamide CAS：103

98% Quality Protein Peptide Hormones 2Mg/vial White Cjc1295 Without Dac CAS 863288-34-0

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Our Adwantage: 1.We have stock so we can delivery quickly at the very day when receive the payment. 2.Best price, first class service, high successful delivery rate. A discount would be given when you make a large order. 3.High quality gua

Hubei Xinrunde Chemical Co., Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(s)

CJC1295

Min.Order: 100 Kilogram

FOB Price:  USD $ 0.0-0.0/Kilogram

CJC1295 Basic information

Henan Sunlake Enterprise Corporation is located in Henan Province , the central plain of China , which enjoys favorable geogeaphical position and convenient transportion. The compa

High Purity Fat Burning Cjc-1295 Peptide

Min.Order: 10 Gram

FOB Price:  USD $ 120.0-120.0/Gram

Our Advantages: 1). delivery:within 24 hour deliver after payment usaually . 2). price and quality :much lower price than the market price with same quality.and each goods is elite,we just send best quality goods. 3). best after sale servic

Linyi dingsheng chemical Co., Ltd is located in Shandong province, China, which specialized in chemicals such as research chemical ,pharmaceutical intermediates and other fine chem

CJC1295 without DAC

Min.Order: 1 Gram

FOB Price:  USD $ 1.0-1.5/Gram

We promise our customer following items 1.Reasonable price: We provide high quality products with competitive price in China, 2.Low MOQ: No worry about the low MOQ, our MOQ is 1 gram or lower. 3.Good and efficient Service, G

Company Introduction Founded in 1996, Baowei Technology Group is specialized in the R&D, designing, manufacturing in series of the new high- tech chemical materials and related pro

CJC1295 Cjc-1295 Without Dac 863288-34-0

Min.Order: 10 Gram

FOB Price:  USD $ 2.0-2.0/Gram

Advantage of Our Company (1)Fast discreet delivery with great shipping success! (2)Pictures with your order & details! (3)We will provide you the tracking number! (4)Keep track of your goods untill the goods are sent in to your hand

We, Shanghai ShuCan Industrial Co.,Ltd, is one of the leading manufacturers, exporters, suppliers &traders of high quality Testosterone Enanthate, Testosterone Steroids, Steroids P

Factory supply Peptide CAS NO. 863288-34-0 CJC 1295 DAC

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Factory supply Peptide CAS NO. 863288-34-0 CJC 1295 DAC 1.Professional manufaucture and supplier 2.High purity 3.Lowest price 4.Powerful and professional forwarder Appearance:White powder Storage:Stored in the dry and ventilated inside stor

ZhiShang Chemical is owned by ZhiShang Group, is a professional new-type chemicals enterprise combined into research and development, production and sales . The company's competit

Casno:

863288-34-0

MSDS/COA Download

CJC-1295 Acetate CAS NO.863288-34-0

Min.Order: 5 Kiloliter

FOB Price:  USD $ 0.8-1.0/Kiloliter

High quality, best service,competitive price are our principle Our strength We have clients throughout the world： Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet y

Hebei chongbao biological technology co., LTD is a high technology researching company focusing on the health and medicine business of creating better life for people. we mainly p

CJC-1295 Acetate without DAC 863288-34-0

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

1.High quality : the purity is 99% min . through multiple producing procedures. 2.Competitive price : low price because of our skilled production technolpgy ,save the production cost at most , and give big profit room to our customers

Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Run-Biotech provides a broad and integrated portfolio of services throughout the drug R&D process. Our services are designed to help our worldwide customers shorten the discovery and development time and lower the cost of drug and medical devic

Dine products include organic reagents, inorganic reagents and biochemical reagents, including pharmaceutical intermediates, bulk drugs, catalysts, high purity solvents, specialty

CJC-1295 with DAC Peptides for Muscle Gaining Injectable CAS NO.863288-34-0

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Minimum Order Qty. 10 Gram

We, Jilin Tely Imp & Exp Co., Ltd. mainly supply and export products including: pharmaceutical raw materials,Chemical reagents, Food additives, pharmaceutical and pesticide interme

Mgf /Mechano Growth Factor Purchase Peptides For increase muscle mass

Min.Order: 1 Gram

FOB Price:  USD $ 1.0-1.0/Gram

1, High quality with competitive price: 1)Purity≥ 99% 2)We are manufacturer and can provide high quality products with factory price,offering free samples to test, a few shipping fee only. 2.Flexible Payment term

Wuhan Honor Bio-Pharm Co., Ltd. is located at Wuhan, Hubei province of China. It is a high-tech enterprise professionally has been devoting itself in research, development and sale

igf-1 hot sale CAS NO.863288-34-0

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0/Gram

hebei qiute trade co.,ltd is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including Intermediates & API, Catalyst, Electro

Hebei qiute trade co.,ltd is a leading supplier of fine chemical in China, is located in hebei. The unique geographical conditions of hebei are favorable for transportation. The co

Global Sell CJC-1295 Without Dac, CJC1295 No Dac, Cjc 1295

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Sichuan Jisheng Biopharmaceutical Co.,Ltd is specializing of peptide and pharmaceutical intermediates. all of our products are produced in accordance with GMP standard and are exceeded in international quality standards. We are a leading peptide

Our company is located in Deyang, a typical city of Sichuan - with beautiful scenery and mild climate. It occupies a total area of 16,000 square meters. We are a specialized manufa

Global Sell Cjc-1295 Without Dac, Cjc1295 No Dac, CJC 1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 100.0-100.0/Kilogram

Sincere recruitment of global agents, preferential conditions! whatsapp/wechat:+8615130202468 Sample for free! Crovell is specialized in pharmaceutical intermediates, veterinary drug intermediates and dyes intermediates,suc

Thanks for your considering of Crovell Biotech (Hebei) Co., Ltd. Crovell is a fast growing intermediates company,Which located in Shijiazhuang,Hebei Province. Crovell is speciali

Casno:

863288-34-0

MSDS/COA Download

CJC1295 Without DAC manufacturer

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Our Advantages: 1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%. 2. Samples free trial: our company welcome samples to test our quality the

Hangzhou Peptidego Biotech. Co.,Ltd is an internationally recognized biochemical manufacturing company which specialized in the production of peptide reagents, custom peptides and

Casno:

863288-34-0

MSDS/COA Download

Pepides CJC1295dac with 2mg/vial

Min.Order: 10 Gram

FOB Price:  USD $ 3.0-5.0/Gram

About Our Company This is Grace from Zhengzhou Filter Biotechnology Co.,Ltd.We are the professional supplier of peptide products in China over 10 years. we have Professional Lab to confirm the Quality and Serive for all clients in long-term run

Filter Biotechnology Co., Ltd is a High-Tech Bio-Chemical Enterprise which is integrated by Professional Scientific R&D, Mass production and Sales. As a world-leading Provider

Global sale CJC-1295 Without Dac, CJC1295 No Dac, CJC 1295

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

1.High Quality: Quality is life. Quality is the most important element for all goods. We have a lab doing research in Wuhan China and produce sarms in bulk quantity. We have 8 years experience making all kinds of sarms. And all our old customers

HK WONDA PHARMACEUTICAL AND CHEMICAL LIMITED is specializing in custom synthesis, manufacture and import & export of fine chemicals, APIs and pharmaceutical intermediates. WONDA P

CJC-1295 Acetate without DAC

Min.Order: 0

FOB Price:  USD $ 0.0-0.0/

high quality & timely delivery Storage:MSDS reference Package:Bag/Bottle/Drum Application:organic and speciality chemicals Transportation:by courier/air/sea Port:Shanghai

Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

CJC 1295

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Superior quality, moderate price & quick delivery. Appearance:White Lyophilized Powder Storage:Stored in cool, dry and ventilation place; Away from fire and heat Package:1kg/bag, 1kg/drum or 25kg/drum or as per your request. Application:Used as

Hangzhou Yunuo Chemical Co., Ltd. is located in Hangzhou City, China We are specialized in fine chemicals and basic chemical auxiliary materials, Organic compounds, rubber

Casno:

863288-34-0

MSDS/COA Download

Cjc-1295 2mg/vial CJC-1295 cjc1295 CJC1295

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0/Gram

Appearance: White Lyophilized Powder Application: bodybuilding, Muscle growth ,Therapeut... DeliveryTime: within a week PackAge: Discreet packing ways as your requirem... Port: shenzhen hongkong

Guangzhou XinKe Chemical Co., LTD is a leading Chinese chemical supplier specialized in hormone steroid powders, Steroids injectable liquids, our company integrates R&D, producing,

TIANFUCHEM--CJC1295

Min.Order: 1 Metric Ton

FOB Price:  USD $ 20.0-20.0/Metric Ton

Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl

Our company engages in Electronic chemicals such as OLED，Photoresist chemical，Electrolyte additive and Intermediate Pharmaceutical production; development of noble metal catalysts,

CJC1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.9-1.0/Kilogram

LIDE PHARMACEUTICALS LIMITED is a professional chemicals and APIs leading manufacturer in China. Our core business line covers APIs, Intermediates, Herb extract, etc.

LIDE PHARMACEUTICALS LIMITED is one of the fastest growing pharmaceutical company in China. We have developed strategic partnership with our manufacturing associates having state o

CJC-1295

Min.Order: 1 Gram

FOB Price:  USD $ 10.0-10.0/Gram

Zhejiang J&C Biological Technology Co., Limited is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including Intermediates &a

ZHEJIANG BIOLOGY AND TECHNOLOGY CO., LTD. is a modern professional high-tech enterprise, which is specializing in generic APIs and pharmaceutical intermediates. especially in pepti

CJC-1295

Min.Order: 0 Metric Ton

FOB Price:  USD $ 0.0-0.0/Metric Ton

ProName: CJC-1295 DAC 2mg/vial 5mg/vial Purchas... CasNo: 863288-34-0 Molecular Formula: C165H269N47O46 Appearance: White Crystalline Powder Application: CJC-1295 DAC has shown some amazing re... DeliveryTime: 3-7 days Pa

With 30 years experience in import and export trade, we have been praised as "Focal enterprise for earning foreign exchange in Taizhou", "Advanced export enterprise in Taizhou" and

CJC 1295

Min.Order: 0

FOB Price:  USD $ 0.0-0.0/

Appearance:Solid powder Storage:Sealed,light and oxygen resistant Package:Foil bag or drum Application:Applied in dietary supplements,pharmaceutical or cosmeticeuticals Transportation:by sea or air Port:Beijing or Guangzhou Port

Kono Chem Co.,Ltd is a leading producer of standardized herbal extracts, natural active ingredients and APIs for pharmaceutical, health food and cosmetic industries. Annually, mo

CJC1295 with high quality 95% and good price

Min.Order: 1 Gram

FOB Price:  USD $ 10.0-10.0/Gram

CJC1295（GHRH/DAC） 863288-34-0 Sterile Filtered White lyophilized (freeze-dried) powder Storage : 2~8℃,protected from light Long-term Storage： -20 ± 5 °C Purity>95% Enterprise standard Appearance:Sterile Filtered Whit

Fond Ever Co.,Limited is a high-tech enterprise specialized in the research manufacture and trade of the APIs, pharmaceutical intermediates and bio-chemicals.We will pursue quality