Welcome to LookChem.com Sign In|Join Free

Products

  • or
Home > Pharmaceutical > 86784 > 

86784-80-7

Refine

Refine

Country

Business Type

Certificate

Display

Basic Information
CAS No.: 86784-80-7
Name: CRF (HUMAN, RAT)
Molecular Structure:
Molecular Structure of 86784-80-7 (CRF (HUMAN, RAT))
Formula: C208H344N60O63S2
Molecular Weight: 4757.45
Synonyms: Corticotropin-releasingfactor (sheep), 2-L-glutamic acid-22-L-alanine-23-L-arginine-25-L-glutamicacid-38-L-methionine-39-L-glutamic acid-41-L-isoleucinamide-;Corticobiss;Corticotropin-releasing factor (Mesocricetusauratus);Corticotropin-releasingfactor (human);Human ACTH-releasing factor;Human CRF(1-41);Humancorticorelin;Human corticotropin-releasing factor;Human corticotropin-releasing hormone-41;Human/rat CRF;L-Isoleucinamide, L-seryl-L-a-glutamyl-L-a-glutamyl-L-prolyl-L-prolyl-L-isoleucyl-L-seryl-L-leucyl-L-a-aspartyl-L-leucyl-L-threonyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-arginyl-L-a-glutamyl-L-valyl-L-leucyl-L-a-glutamyl-L-methionyl-L-alanyl-L-arginyl-L-alanyl-L-a-glutamyl-L-glutaminyl-L-leucyl-L-alanyl-L-glutaminyl-L-glutaminyl-L-alanyl-L-histidyl-L-seryl-L-asparaginyl-L-arginyl-L-lysyl-L-leucyl-L-methionyl-L-a-glutamyl-L-isoleucyl-;MCI 028;Rat ACTH-releasing hormone;Rat CRF;Rat CRF(1-41);Rat CRF-41;Ratcorticotropin-releasing factor;Rat corticotropin-releasing factor-41;Rathypothalamic CRF;Rat/human CRF;Rat/human corticotropin-releasing factor;Xerecept;rCRF-41;Corticotropin Releasing Factor, human, rat;
PSA: 2049.59000
LogP: 5.89730
  • Display:default sort

    New supplier

  • High quality Crf (Human, Rat) Acetate supplier in China

  • Casno:

    86784-80-7

    High quality Crf (Human, Rat) Acetate supplier in China

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 0.0-0.0

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

  •  Simagchem Corporation

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592-2680277

    Address:21/F Hualong Office Building,No.6 Hubin East Road, Xiamen,China

       Inquiry Now

  • CRF (human, rat) Acetate 86784-80-7

  • Casno:

    86784-80-7

    CRF (human, rat) Acetate 86784-80-7

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    1.High quality : the purity is 99% min . through multiple producing procedures. 2.Competitive price : low price because of our skilled production technolpgy ,save the production cost at most , and give big profit room to our customers

    Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

  •  Wuhan Fortuna Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-59207850

    Address:Add: Room 2015, No.2 Building, Kaixin Mansion No.107 Jinqiao Avenue, Wuhan, China

       Inquiry Now

  • Factory Price API 99% CRF (HUMAN, RAT) 86784-80-7 GMP Manufacturer

  • Casno:

    86784-80-7

    Factory Price API 99% CRF (HUMAN, RAT) 86784-80-7 GMP Manufacturer

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.1-0.1

    1. Factory price and high quality must be guaranteed, base on 8 years of production and R&D experience2. Free samples will be provided,ensure specifications and quality are right for customer3. Customers will receive the most professional technical s

    Xi'an Xszo Chem Co. Ltd is a wholly-owned subsidiary of the SZO Chem Group. SZO Group is composed of Xi'an Xszo Chem Co. Ltd & Shaanxi SZO Tech Co., Ltd. SZO industry Group have mo

  •  Xi'an Xszo Chem Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-029-88698540

    Address:No.16,Jingqin Rd. JingWei Industrial park,Shaanxi,China,710200

       Inquiry Now

  • CRF (human, rat) Acetate   manufacturer with low price

  • Casno:

    86784-80-7

    CRF (human, rat) Acetate manufacturer with low price

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    We can provide GMP validation service that complies with SFDA, FDA, WHO and EU EMPA.Excellent registration team could help us easlily to register our products in different countries.If you and your customer are interested in some products or need C

    Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd (JL Pharm) is established in 2012 at the beautiful West Lake – Hangzhou city, China. The company's main business includes R&D, Produ

  •  Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-571-85829053

    Address:Rm A606, Fuyi Center, jianqiao street, Jianggan Area

       Inquiry Now

  • CRF (HUMAN, RAT)  86784-80-7

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT) 86784-80-7

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 15.0-50.0

    Our Advantage Rich Experience Our products are sold all over Europe,North&South America, Sino-East, Asia and pacific area as well as Africa,we establish long term. Quality service Company cooperates with research institutes. We strictly con

    Our company specializes in processing and selling chemical raw materials, chemical th Asia, Europe, America, Africa and other more than 20 countries and regions. ? Companies adheri

  •  Hebei Nengqian Chemical Import and Export Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 15632961819

    Address:hebei

       Inquiry Now

  • Manufacturer supply CAS 86784-80-7 with best quality

  • Casno:

    86784-80-7

    Manufacturer supply CAS 86784-80-7 with best quality

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 139.0-210.0

    WITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et

    Zhuo Zhou Wen Xi Import and Export Co., Ltd. is a company mainly engaged in the export of pharmaceutical raw materials. Its parent company is (Wen Xi Pharma), including three subs

  •  Zhuozhou Wenxi import and Export Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-13111626072

    Address:Room 1710, Baoxin International Phase I, 19 Guanyun East Road, Zhuozhou, Hebei

       Inquiry Now

  • CRF (HUMAN, RAT) CAS:86784-80-7

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT) CAS:86784-80-7

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    CRF (HUMAN, RAT) CAS:86784-80-7 Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, specializing in high quality organic intermed

    Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, speciali

  •  Qingdao Beluga Import and Export Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+8613854236000

    Address:qingdao

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Henan Wentao Chemical Product Co.,Ltd is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds, which are widely used in the fields of prod

    The company is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds,

  •  Henan Wentao Chemical Product Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-370-2722992

    Address:32 Room, 5th Floor, Building 11, No. 6 Yinxing Road, High-tech Industrial Development Zone, Zhengzhou City, Henan Province

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Hello, dear friend! I'm Hansen and Allen from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by emai

    Shandong Hanjiang Chemical Co., Ltd. is located in Zibo City, Shandong Province, China. It is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids

  •  Shandong Hanjiang Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 18369939125

    Address:No.25A Qilu Industrial Park

       Inquiry Now

  • CRF (human, rat)

  • Casno:

    86784-80-7

    CRF (human, rat)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Hello, dear friend! Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by email in time. product quality 1.The product quality h

    Jiangsu Xinsu New Materials Co., Ltd. is a chemical enterprise integrating R&D, production and sales of fine chemical products. It has been intensively cultivating various types of

  •  Jiangsu Xinsu New Materials Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:186-624-33356

    Address:High speed Railway New City, Xiangcheng District, Suzhou City, Jiangsu Province

       Inquiry Now

  • High Quality And Best price CRF (HUMAN, RAT) 98%

  • Casno:

    86784-80-7

    High Quality And Best price CRF (HUMAN, RAT) 98%

    Min.Order: 5 box

    FOB Price:  USD $ 10.0-10.0

    Company introduction Hebei Muhuang Technology Co., Ltd was established in 2023. Although we are a very young company, our leaders have been working in the chemical industry for 20 years. We believe that our company can bring you perfect customer ex

    Hebei Muhuang Technology Co., Ltd was established in 2023. Although we are a very young company, our leaders have been working in the chemical industry for 20 years. We believe tha

  •  Hebei Muhuang Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+8618332173750,+8613191862208

    Address:石家庄桥西区仁和嘉园3号楼1单元702

       Inquiry Now

  • Corticotropin Releasing Factor, human, rat 86784-80-7 leading suppier

  • Casno:

    86784-80-7

    Corticotropin Releasing Factor, human, rat 86784-80-7 leading suppier

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • CRF (HUMAN, RAT)  86784-80-7

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT) 86784-80-7

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 0.0-0.0

    Our company was built in 2009 with an ISO certificate.In the past 6 years, we have grown up as a famous fine chemicals supplier in China and we had established stable business relationships with Samsung,LG,Merck,Thermo Fisher Scientific and so

    Welcome to Henan Tianfu Chemical Co., Ltd. Our company engages in noble metal catalysts, synthesis of electronic chemical materials and Pharmaceutical, Agrochemicals, Food Additive

  •  Henan Tianfu Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • CRF (HUMAN, RAT)

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT)

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. W

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, s

  •  Shandong Mopai Biotechnology Co., LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-15965530500

    Address:shandong

       Inquiry Now

  • CRF

  • Casno:

    86784-80-7

    CRF

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    1. A strong scientific research team . 2. Stable quality (with a complete scientific research center and testing center to ensure the quality stability of each batch of products). 3. Rich export experience (with practical experience in exporting to

    Hangzhou Shanyi Biotechnology Co., Ltd. is headquartered in Hangzhou, China. It is a high-tech enterprise specializing in the research and development, production, development, and

  •  Hangzhou Shanyi Biotechnology Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:s-086-18093761022

    Address:Guodu Development Building

       Inquiry Now

  • CRF (HUMAN, RAT)

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT)

    Min.Order: 1 Gram

    FOB Price:  USD $ 10.0-10.0

    LIDE PHARMACEUTICALS LIMITED is a professional leading manufacturer of chemicals and APIs in China. Our core business line covers APIs, Intermediates, Flavours and fragrances, Specialty chemicals, Dietary additives etc.We are specialized in chemical

    LIDE PHARMACEUTICALS LIMITED is one of the fastest growing pharmaceutical company in China. We have developed strategic partnership with our manufacturing associates having state o

  •  LIDE PHARMACEUTICALS LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-25-58409506

    Address:11F, Building A1, No.288 North Zhongshan Road, Gulou District, Nanjing,210003, P.R.China.

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High quality,stable supply chain.Appearance:white/off-white or light yellow Storage:Store in cool and dry place, keep away from strong light and heat. Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Application:This product can be use

    Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

  •  Suzhou Health Chemicals Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-512-58277800

    Address:No. 338, Jingang Avenue,

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Appearance:Solid powder Storage:Sealed,light and oxygen resistant Package:Foil bag or drum Application:Applied in dietary supplements,pharmaceutical or cosmeticeuticals Transportation:by sea or air Port:Beijing or Guangzhou Port

    Kono Chem Co.,Ltd is a leading producer of standardized herbal extracts, natural active ingredients and APIs for pharmaceutical, health food and cosmetic industries. Annually, mo

  •  Kono Chem Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-29-86107037-8015

    Address:No.11 Daqing Road,Lianhu District,Xi’an 710082,China

       Inquiry Now

  • CRF (human, rat) Acetate

  • Casno:

    86784-80-7

    CRF (human, rat) Acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Enterprise standard Package:10mg,100mg, 500mg, 1g ,10g, 100g 500g, 1kg Application:Peptide Drugs

    Hangzhou Dingyan Chem Co., LTD. is located in the beautiful tourist city of hangzhou, is a comprehensive chemical enterprice which doing import and export business by its own comp

  •  Hangzhou Dingyan Chem Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-86465881,86-571-87157530,86-571-88025800

    Address:RM.1118,NO.1 Building, Baiyun Tower,Jianggan Area, Hangzhou city, China,310004

       Inquiry Now

  • Crf (Human, Rat) Acetate

  • Casno:

    86784-80-7

    Crf (Human, Rat) Acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Crf (Human, Rat) Acetate supplierAppearance:White to off-white powder Storage:Keep away of light,cool place Package:25kg/drum;200kg/drum Application:API Transportation:Sea/air/courier

    Orchid Chemical was established in 2009; we are headquartered in Hangzhou, which is 200 km from China's biggest sea port, Shanghai. Orchid chemical is a joint-venture company, com

  •  ORCHID CHEMICAL SUPPLIES LTD

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-571-85395792

    Address:607, North Zhongshan Road, Hangzhou 310000 China

       Inquiry Now

  • CRF (HUMAN, RAT)

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    high quality Storage:Sealed, dry, microtherm , avoid light and smell. Package:According to the demand of customer Application:Organic synthesis Transportation:by air or by sea

    Located in Zhengdong New District,?Zhengzhou of Henan province, Henan Allgreen Chemical Co.,Ltd is a comprehensive high-tech modern enterprises integrating professional R&D, pro

  •  Henan Allgreen Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-0371-87507775

    Address:No 260 Dongming Road,Jinshui District

       Inquiry Now

  • Crf (Human, Rat) Acetate

  • Casno:

    86784-80-7

    Crf (Human, Rat) Acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Our clients, like BASF,CHEMO,Brenntag,ASR,Evonik,Merck and etc.Appearance:COA Storage:in stock Application:MSDS/TDS

    Xiamen Aeco Chemical Industrial Co., Ltd(same as Aecochem Corp.) An ISO 9001:2015 Certified Company Your Partner in China, a Professional chemical raw material supplier, our

  •  Aecochem Corp.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592 599 8717

    Address:No 611 Sishui Road,Huli

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Ansciep Chemical is a professional enterprise manufacturing and distributing fine chemicals and speciality chemicals. We have been dedicated to heterocycle compounds and phenyl rings for tens of years. This is our mature product for export. Our quali

    Antimex Chemical Limied, was founded in 2001, we are specializing in manufacturing & researching of Active pharmaceutical Ingredients,Veterinary pharm APIs,cosmetic ingredients,and

  •  Antimex Chemical Limied

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0086-21-50563169

    Address:Room1027,No.Jinyu Road,Pudong

       Inquiry Now

  • CRF Acetate; CAS No.86784-80-7

  • Casno:

    86784-80-7

    CRF Acetate; CAS No.86784-80-7

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Appearance:solid or liquid Storage:sealed in cool and dry place Package:As customer's requested Application:Pharma Intermediate Transportation:by courier/air/sea Port:Any port in China

    Guangdong Juda Chemical Industrial Co.,Limited is a company specializing in APIs,pharmaceutical intermediates, electronic chemicals, plant extracts,fine chemicals and cosmetics raw

  •  Guangdong Juda Chemical Industrial Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 13510152023(whatsapp)

    Address:Guangzhou chemical city Tianhe District Guangzhou Guangdong China

       Inquiry Now

  • CRF (HUMAN, RAT)

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    best seller Application:API

    DB Biotech co., ltd is a global and professional supplier for plant extracts and functional ingredients, the company is based in XI’an city, which is famous city for the producttio

  •  DB BIOTECH CO., LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86--1829 2989 553

    Address:No.99 Road, Xi'an, China

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    We are committed to providing our customers with the best products and services at the most competitive prices.Appearance:white powder Storage:Room temperature with sealed well Package:according to the clients requirement Application:Use as primary a

    BOC Sciences is a brand of BOCSCI Inc. We leverage our wide spectrum of business in the fields of development, manufacturing, marketing, and distribution to help you make best-info

  •  BOC Sciences

    United States  |  Contact Details

    Business Type:Trading Company

    Tel:1-631-485-4226

    Address:Ramsey Road

       Inquiry Now

  • CRF (human, rat) Acetate

  • Casno:

    86784-80-7

    CRF (human, rat) Acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    CRF (human, rat) AcetateAppearance:white crystalline powder Storage:Store in dry, dark and ventilated place Package:25KG drum Application:pharmaceutical intermediate Transportation:by air, by sea, by express

    Welcome to Hangzhou Fandachem Co.,Ltd (www.FandaChem.com) Hangzhou Fandachem Co.,Ltd (Fandachem),an experienced and professional China-based Fine Chemical supplier. We supply the

  •  Hangzhou Fandachem Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-571-28800458

    Address:Room 5010, No.9 YanAn Road,Hangzhou,Zhejiang,China

       Inquiry Now

  • CRF(human,rat)Acetate

  • Casno:

    86784-80-7

    CRF(human,rat)Acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Best quality with low price Storage:ln stock Package:25kg/Barrel Application:Chemicals Transportation:Express/Sea/Air Port:Shanghai

    Sartort Biopharma is a leading company engaging in the production of Intermediates, fine chemicals, Ionic liquids and 3D printing materials. It has such controlled subsidiaries as

  •  Hangzhou Sartort Biopharma Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-28069376

    Address:914-915, Bldg. 16, No. 57, Tech Park Road, Baiyang Street, Economic And Technological Development Zone

       Inquiry Now

  • CRF (human, rat) acetate

  • Casno:

    86784-80-7

    CRF (human, rat) acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    86784-80-7 Application:intermediate

    SAGECHEM is a chemical R&D, manufacturing and distribution company since 2009, including pharmaceutical intermediates, agrochemical, dyestuff intermediates, organosilicone, API and

  •  SAGECHEM LIMITED

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-86818502

    Address:5Fl. 501Room, Tower A, New Youth Plaza, 8 Jia Shan Road, Hangzhou, China

       Inquiry Now

  • CRF Acetate;

  • Casno:

    86784-80-7

    CRF Acetate;

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    *stable and better quality products*efficient and meticulous servicesAppearance:Powder Storage:Store in dry, cool and ventilated place Package:1kg/tin 5kg/tin 25kg/carton Application:Pharmaceutical raw materials, making injection powder oral agent Tr

    ASURE BIOCHEM Co., Ltd was established in March 2016. It is located in Hangzhou, a very beautiful city. It is a comprehensive chemical service provider with business scope coverin

  •  Asure Biochem CO.,LTD.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15068760982

    Address:hangzhou

       Inquiry Now

  • CRF (HUMAN, RAT)

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    best seller Application:API

    Wuhan Bright Chemical Co., Ltd is set up in 2008. We mainly concentrate on producing, researching and trading electroplating intermediates, Fluoro -containing chemicals,Silicone o

  •  Wuhan Bright Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-27-85804899

    Address:Rm 9FC11,Caishen plaza,Hankou trainstation Wuhan,CN

       Inquiry Now

  • Corticotropin Releasing Factor human, rat

  • Casno:

    86784-80-7

    Corticotropin Releasing Factor human, rat

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    good quality, competitive price, thoughtful after sale serviceAppearance:white powder Storage:Keep it in dry,shady and cool place Package:500ug Application:Pharma;Industry;Agricultural;chemical reaserch Transportation:by express or by sea Port:Any po

    Shanghai Yuanye Bio-Technology Co., Ltd. is a comprehensive enterprise of life science, specializing in the research, development and sales of biochemical reagents, analytical stan

  •  Shanghai Yuanye Bio-Technology Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-21-61845781

    Address:Building 6, No. 465, Changta Road,Songjiang District,Shanghai,China

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Best Seller, High Quality, Competitive Price, Fast Delivery, Quick ResponseAppearance:powder, or liquid Storage:Stored in room temperature, ventilated place Package:Bottle, barrel, cargo, container, etc. Application:Pharmaceuticals, intermediates, AP

  •  LEAP CHEM Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0571-87317139

    Address:hangzhou

       Inquiry Now

  • CRF (human and rat) 86784-80-7

  • Casno:

    86784-80-7

    CRF (human and rat) 86784-80-7

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    1.No Less 8 years exporting experience. Clients can 100% received goods 2.Lower Price with higher quality 3,Free sample 4,We are sincerely responsible for the "product quality" and "After Service" Upbio is Specialized

    Shanghai Upbio Tech Co.,Ltd (Former Onchem (China)Co.,Ltd) is a comprehensive manufacturer and an international distribution of chemicals throughout the world, The predecessor of

  • Shanghai Upbio Tech Co.,Ltd(expird)

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-21-52196435

    Address:No.2 Floor,No.979 Yunhan Rd,Nicheng,Pudong New Area,Shanghai,China

       Inquiry Now

  • Pharmaceutical raw material CRF (human,rat)

  • Casno:

    86784-80-7

    Pharmaceutical raw material CRF (human,rat)

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0

    Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing th

    Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. We are dedicating to be the most professional, efficient,and reliable partner fo

  • Chengdu Youngshe Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-28-62328193

    Address:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China

       Inquiry Now

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 86784-80-7

Chemistry

Chemical Name: CRF (HUMAN, RAT)
CAS No.: 86784-80-7
RTECS: GM7925000
Molecular Formula: C208H344N60O63S2
Molecular Weight: 4757.45 g/mol
Storage temp.: -20°C
Product Categories about Human corticotropin-releasing factor (CAS No.:86784-80-7) are Peptide ; CRF receptor and related
The chemical synonymous of Human corticotropin-releasing factor (CAS No.:86784-80-7) are SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2 ; SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 ; Corticotropin releasing factor ; Corticotropin releasing factor (CRF), human, rat ; Corticotropin releasing factor, human ; Corticotropin releasing factor, human and rat ; Corticotropin releasing factor human, rat ; CRF, human and rat

Toxicity Data With Reference

1.    

ivn-rat LD50:>1 mg/kg

    YACHDS    Yakuri to Chiryo. Pharmacology and Therapeutics. 20 (Suppl 5),(1992),S1241.
2.    

ivn-dog LD50:>1 mg/kg

    YACHDS    Yakuri to Chiryo. Pharmacology and Therapeutics. 20 (Suppl 5),(1992),S1241.

Safety Profile

Moderately toxic by intravenous route. Experimental reproductive effects. When heated to decomposition it emits toxic vapors of NOx and SOx.