Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 86784 > 

86784-80-7

Basic Information
CAS No.: 86784-80-7
Name: CRF (human and rat)
Molecular Structure:
Molecular Structure of 86784-80-7 (CRF (human and rat))
Formula: C208H344N60O63S2
Molecular Weight: 4757.45
Synonyms: Corticotropin-releasingfactor (sheep), 2-L-glutamic acid-22-L-alanine-23-L-arginine-25-L-glutamicacid-38-L-methionine-39-L-glutamic acid-41-L-isoleucinamide-;Corticobiss;Corticotropin-releasing factor (Mesocricetusauratus);Corticotropin-releasingfactor (human);Human ACTH-releasing factor;Human CRF(1-41);Humancorticorelin;Human corticotropin-releasing factor;Human corticotropin-releasing hormone-41;Human/rat CRF;L-Isoleucinamide, L-seryl-L-a-glutamyl-L-a-glutamyl-L-prolyl-L-prolyl-L-isoleucyl-L-seryl-L-leucyl-L-a-aspartyl-L-leucyl-L-threonyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-arginyl-L-a-glutamyl-L-valyl-L-leucyl-L-a-glutamyl-L-methionyl-L-alanyl-L-arginyl-L-alanyl-L-a-glutamyl-L-glutaminyl-L-leucyl-L-alanyl-L-glutaminyl-L-glutaminyl-L-alanyl-L-histidyl-L-seryl-L-asparaginyl-L-arginyl-L-lysyl-L-leucyl-L-methionyl-L-a-glutamyl-L-isoleucyl-;MCI 028;Rat ACTH-releasing hormone;Rat CRF;Rat CRF(1-41);Rat CRF-41;Ratcorticotropin-releasing factor;Rat corticotropin-releasing factor-41;Rathypothalamic CRF;Rat/human CRF;Rat/human corticotropin-releasing factor;Xerecept;rCRF-41;Corticotropin Releasing Factor, human, rat;
EINECS:
Density:
Melting Point:
Boiling Point:
Flash Point:
Solubility:
Appearance:
Hazard Symbols:
Risk Codes:
Safety:
Transport Information:
PSA: 2049.59000
LogP: 5.89730
  • Display:default sort

    New supplier

  • High quality Crf (Human, Rat) Acetate supplier in China

  • Casno:

    86784-80-7

    High quality Crf (Human, Rat) Acetate supplier in China

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

  •  Simagchem Corporation

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592-2680277

    Address:21/F Hualong Office Building,No.6 Hubin East Road, Xiamen,China

       Inquiry Now

  • CRF (human, rat) Acetate   manufacturer with low price

  • Casno:

    86784-80-7

    CRF (human, rat) Acetate manufacturer with low price

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    We can provide GMP validation service that complies with SFDA, FDA, WHO and EU EMPA.Excellent registration team could help us easlily to register our products in different countries.If you and your customer are interested in some products or need C

    Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd (JL Pharm) is established in 2012 at the beautiful West Lake – Hangzhou city, China. The company's main business includes R&D, Produ

  •  Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-571-85829053

    Address:Rm A606, Fuyi Center, jianqiao street, Jianggan Area

       Inquiry Now

  • Manufacturer supply CAS 86784-80-7 with best quality

  • Casno:

    86784-80-7

    Manufacturer supply CAS 86784-80-7 with best quality

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 139.0-210.0/Kilogram

    WITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et

    Zhuo Zhou Wen Xi Import and Export Co., Ltd. is a company mainly engaged in the export of pharmaceutical raw materials. Its parent company is (Wen Xi Pharma), including three subs

  •  Zhuozhou Wenxi import and Export Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-13111626072

    Address:Room 1710, Baoxin International Phase I, 19 Guanyun East Road, Zhuozhou, Hebei

       Inquiry Now

  • CRF (human and rat) 86784-80-7

  • Casno:

    86784-80-7

    CRF (human and rat) 86784-80-7

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    1.No Less 8 years exporting experience. Clients can 100% received goods 2.Lower Price with higher quality 3,Free sample 4,We are sincerely responsible for the "product quality" and "After Service" Upbio is Specialized

    Shanghai Upbio Tech Co.,Ltd (Former Onchem (China)Co.,Ltd) is a comprehensive manufacturer and an international distribution of chemicals throughout the world, The predecessor of

  •  Shanghai Upbio Tech Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-21-52196435

    Address:No.2 Floor,No.979 Yunhan Rd,Nicheng,Pudong New Area,Shanghai,China

       Inquiry Now

  • CRF (human, rat) Acetate 86784-80-7

  • Casno:

    86784-80-7

    CRF (human, rat) Acetate 86784-80-7

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    1.High quality : the purity is 99% min . through multiple producing procedures. 2.Competitive price : low price because of our skilled production technolpgy ,save the production cost at most , and give big profit room to our customers

    Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

  •  Wuhan Fortuna Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-59207850

    Address:A2705,Dong Yi Shi Qu,129# XinHua Road,WuHan,China

       Inquiry Now

  • CRF (human and rat) CAS 86784-80-7

  • Casno:

    86784-80-7

    CRF (human and rat) CAS 86784-80-7

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.01/Kilogram

    Superiority As a professional chemical company, we devote to the development, production and trade of fine chemicals, organic compounds, intermediates, apis and customized chemicals for more than 20 years and have passed iso9001 quality m

    Wuhan Monad Medicine Tech Co.,LTD is a research and development, production, sales in one high-tech company, own about 100 kinds of products, can provide about more than 30000 kind

  •  Wuhan Monad Medicine Tech Co.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+8613397160123

    Address:13th Floor, Tower B, Century Plaza, Zhongnan Road, Wuchang District, Wuhan, China.

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Hello, dear friend! I'm Hansen and Allen from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by emai

    Shandong Hanjiang Chemical Co., Ltd. is located in Qilu Petrochemical Industrial Park, Zibo City, Shandong Province, involving pesticide, medicine, chemical industry, coating, dy

  •  Shandong Hanjiang Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:18369939125

    Address:95A, Xingyuan East Road, Zhangdian District

       Inquiry Now

  • CRF (human, rat) Acetate factory supply

  • Casno:

    86784-80-7

    CRF (human, rat) Acetate factory supply

    Min.Order: 20 Milligram

    FOB Price:  USD $ 0.0-0.0/Milligram

    Our advantages: 1, High quality with competitive price: 2, Fast and safe delivery 3.Excellent pre-sales and after-sales service 4. Well-trained and professional technologist and sales with rich experience in the field for 5-10 years Appearanc

    Hangzhou Clap Technology Co., Ltd is a leading manufacturer and supplier of API, Pharma intermediates, organic and inorganic compounds, rare earth, pesticide, raw drugs, fine chemi

  •  HANGZHOU CLAP TECHNOLOGY CO,.LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-571-88216897、88216896

    Address:Room 4198,Floor 4,No.4,ShanXian Road XiaCheng District,HangZhou city,ZheJiang province,China

       Inquiry Now

  • CRF (human and rat) 86784-80-7

  • Casno:

    86784-80-7

    CRF (human and rat) 86784-80-7

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0/Gram

    The company is a high-tech enterprise providing comprehensive customer service for pharmaceutical companies at home and abroad in accordance with international standards. Our business includes research, development, process optimization and productio

    Prime Molecular Co., Ltd. is an advanced chemical intermediates manufacture with ?two R&D centers and two production sites in China, all well-equipped with dedicated and profession

  •  PRIME MOLECULAR CO.,LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0852-95636137

    Address:Hong Kong

       Inquiry Now

  • CRF (HUMAN, RAT)

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 100.0-100.0/Kilogram

    HangYu Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. HangYu Chemical consis

    Zibo HangYu Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals

  •  Zibo Hangyu Import&Export Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15988566987

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • CRF (HUMAN, RAT)

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT)

    Min.Order: 1 Gram

    FOB Price:  USD $ 10.0-10.0/Gram

    Superiority: Zhejiang J&C Biological Technology Co., Limited is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including I

    ZHEJIANG BIOLOGY AND TECHNOLOGY CO., LTD. is a modern professional high-tech enterprise, which is specializing in generic APIs and pharmaceutical intermediates. especially in pepti

  •  Zhejiang J&C Biological Technology Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0570-4045877

    Address:46# zhongshan road, quzhou zhejiang

       Inquiry Now

  • High Purity Crf (Human, Rat) Acetate

  • Casno:

    86784-80-7

    High Purity Crf (Human, Rat) Acetate

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    BaiFuChem is a Professional chemical raw material supplier in China, our main products include Biochemical , Pharma Intermediate and Organic chemical etc. BaiFuChem have wealth of products,experience , expertise and state-of-the-art

    BaiFuChem is a Professional chemical raw material supplier in China, our main products include Biochemical , Pharma Intermediate and Organic chemical etc. BaiFuChem have wea

  •  Xiamen BaiFuchem Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86 592 605 6448

    Address:No.31 Pingshan South Road, HaiCang District, Xiamen, China

       Inquiry Now

  • CRF (HUMAN, RAT)/ 86784-80-7/ 99% IN STOCK

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT)/ 86784-80-7/ 99% IN STOCK

    Min.Order: 1 Gram

    FOB Price:  USD $ 10.0-20.0/Gram

    High purity with HPLC & NMR chart 99% purity with low price in stock specilized in hard-to-find chemicals Appearance:White powder Storage:keep away from heat,sparks and flames Package:1 gram/bag Application:polypeptide Transportation:by cou

    Tianyuan pharmaceutical company in Zhangjiang Eastern has built 500 square meters of pilot laboratories, equipped with two sets of 50L glass reactor, four sets of 100L double react

  •  Shenzhen Tianyuan Pharmaceutical Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-755-23284190

    Address:B302,2 unit, Jin Lian Building, No. 134 Qianjin 2 Road, Taoyuan village, Xixiang Street, Baoan,Shenzhen,China

       Inquiry Now

  • CRF (HUMAN, RAT)  86784-80-7

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT) 86784-80-7

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    Our company was built in 2009 with an ISO certificate.In the past 6 years, we have grown up as a famous fine chemicals supplier in China and we had established stable business relationships with Samsung,LG,Merck,Thermo Fisher Scientific and so

    Welcome to Henan Tianfu Chemical Co., Ltd. Our company engages in noble metal catalysts, synthesis of electronic chemical materials and Pharmaceutical, Agrochemicals, Food Additive

  •  Henan Tianfu Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • Corticotropin Releasing Factor, human, rat

  • Casno:

    86784-80-7

    Corticotropin Releasing Factor, human, rat

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    *High density and high throughput: simultaneous determination of tens of thousands of protein peptide biochemical reactions*High specificity: deeply reveal the protein binding mechanism, accurately locate the specific epitope of antibody and protein

  •  Chinapeptides Co,. Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-021-50792271

    Address:Building 24A, 300 Chuantu Road, Chuansha, Pudong new area, Shanghai, China, 201202

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Appearance:Solid powder Storage:Sealed,light and oxygen resistant Package:Foil bag or drum Application:Applied in dietary supplements,pharmaceutical or cosmeticeuticals Transportation:by sea or air Port:Beijing or Guangzhou Port

    Kono Chem Co.,Ltd is a leading producer of standardized herbal extracts, natural active ingredients and APIs for pharmaceutical, health food and cosmetic industries. Annually, mo

  •  Kono Chem Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-29-86107037-8015

    Address:No.11 Daqing Road,Lianhu District,Xi’an 710082,China

       Inquiry Now

  • Crf (Human, Rat) Acetate

  • Casno:

    86784-80-7

    Crf (Human, Rat) Acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Our clients, like BASF,CHEMO,Brenntag,ASR,Evonik,Merck and etc.Appearance:COA Storage:in stock Application:MSDS/TDS

    Xiamen Aeco Chemical Industrial Co., Ltd(same as Aecochem Corp.) An ISO 9001:2015 Certified Company Your Partner in China, a Professional chemical raw material supplier, our

  •  Aecochem Corp.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592 599 8717

    Address:No 611 Sishui Road,Huli

       Inquiry Now

  • CRF (human, rat) Acetate

  • Casno:

    86784-80-7

    CRF (human, rat) Acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Enterprise standard Package:10mg,100mg, 500mg, 1g ,10g, 100g 500g, 1kg Application:Peptide Drugs

    Hangzhou Dingyan Chem Co., LTD. is located in the beautiful tourist city of hangzhou, is a comprehensive chemical enterprice which doing import and export business by its own comp

  •  Hangzhou Dingyan Chem Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-86465881,86-571-87157530,86-571-88025800

    Address:RM.1118,NO.1 Building, Baiyun Tower,Jianggan Area, Hangzhou city, China,310004

       Inquiry Now

  • Crf (Human, Rat) Acetate

  • Casno:

    86784-80-7

    Crf (Human, Rat) Acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Crf (Human, Rat) Acetate supplierAppearance:White to off-white powder Storage:Keep away of light,cool place Package:25kg/drum;200kg/drum Application:API Transportation:Sea/air/courier

    Orchid Chemical was established in 2009; we are headquartered in Hangzhou, which is 200 km from China's biggest sea port, Shanghai. Orchid chemical is a joint-venture company, com

  •  ORCHID CHEMICAL SUPPLIES LTD

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-571-85395792

    Address:607, North Zhongshan Road, Hangzhou 310000 China

       Inquiry Now

  • CRF (HUMAN, RAT)

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    high quality Storage:Sealed, dry, microtherm , avoid light and smell. Package:According to the demand of customer Application:Organic synthesis Transportation:by air or by sea

    Located in Zhengdong New District,?Zhengzhou of Henan province, Henan Allgreen Chemical Co.,Ltd is a comprehensive high-tech modern enterprises integrating professional R&D, pro

  •  Henan Allgreen Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-0371-87507775

    Address:No 260 Dongming Road,Jinshui District

       Inquiry Now

  • CRF (human, rat)

  • Casno:

    86784-80-7

    CRF (human, rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    With about ten years experiences in the field of pharmaceutical chemicals, Yierdechem has established solid business cooperation relationships with many large companys worldwide.As a leading supplier of API and pharmaceutical intermediates, holds its

    yierdechem is a young and potential team, with about ten years experiences in the field of pharmaceutical intermediate and fine chemicals, yierdechem has established solid business

  •  Hangzhou Yierdechem Co. Ltd

    China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-571-86904883

    Address:903,zhijiang Minglou, Xiasha EDA, Hangzhou City 310018,P.R.China

       Inquiry Now

  • CRF (HUMAN,RAT)

  • Casno:

    86784-80-7

    CRF (HUMAN,RAT)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    FINETECH INDUSTRY LIMITED is a LONDON based CRO company providing drug discovery & development services to worldwide clients. FINETECH INDUSTRY LIMITED supplies the CRF (HUMAN,RAT), CAS:86784-80-7 with the most competitive price and the best quality.

    Finetech Industry Limited is a company in England,which specializing in developing, manufacturing and marketing fine organic compounds and intermediates for the fine chemical and p

  •  Finetech Industry Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-87465837

    Address:wuhan

       Inquiry Now

  • CRF (human, rat) Acetate with approved quality

  • Casno:

    86784-80-7

    CRF (human, rat) Acetate with approved quality

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peditides and natural extract etc. We are capable to supply you with any quanti

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peditide

  •  Wuhan Prominence Bio-technology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:13437110400

    Address:wuhan

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Ansciep Chemical is a professional enterprise manufacturing and distributing fine chemicals and speciality chemicals. We have been dedicated to heterocycle compounds and phenyl rings for tens of years. This is our mature product for export. Our quali

    Antimex Chemical Limied, was founded in 2001, we are specializing in manufacturing & researching of Active pharmaceutical Ingredients,Veterinary pharm APIs,cosmetic ingredients,and

  •  Antimex Chemical Limied

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0086-21-50563169

    Address:Room1027,No.Jinyu Road,Pudong

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Comply with CP,JP,EP,US GradeAppearance:White Solid Storage:Stored under room temperature in cool and dry place Package:In 25KG paper or plastic drums Application:Used as pharmaceutical Intermeidate Transportation:Shipped as non- dangerous chemicals

    Who we are ? Located in Zhengzhou City, China , Henan Daken Chemical Co.,Ltd was Established in June ,1983.We have a 35 years history for fine chemical synthesis .Daken has young

  •  Henan DaKen Chemical CO.,LTD.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-371-55541817

    Address:No.56 Hongzhuan Road,Jinshui,Zhengzhou,450000,China

       Inquiry Now

  • CRF (human, rat) Acetate

  • Casno:

    86784-80-7

    CRF (human, rat) Acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    CRF (human, rat) AcetateAppearance:white crystalline powder Storage:Store in dry, dark and ventilated place Package:25KG drum Application:pharmaceutical intermediate Transportation:by air, by sea, by express

    Welcome to Hangzhou Fandachem Co.,Ltd (www.FandaChem.com) Hangzhou Fandachem Co.,Ltd (Fandachem),an experienced and professional China-based Fine Chemical supplier. We supply the

  •  Hangzhou Fandachem Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-571-28800458

    Address:Room 5010, No.9 YanAn Road,Hangzhou,Zhejiang,China

       Inquiry Now

  • CRF(human,rat)Acetate

  • Casno:

    86784-80-7

    CRF(human,rat)Acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Best quality with low price Storage:ln stock Package:25kg/Barrel Application:Chemicals Transportation:Express/Sea/Air Port:Shanghai

    Sartort Biopharma is a leading company engaging in the production of Intermediates, fine chemicals, Ionic liquids and 3D printing materials. It has such controlled subsidiaries as

  •  Hangzhou Sartort Biopharma Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-28069376

    Address:914-915, Bldg. 16, No. 57, Tech Park Road, Baiyang Street, Economic And Technological Development Zone

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    Name:CRF (human and rat) CAS NO:86784-80-7 Application:Name:CRF (human and rat) CAS NO:86784-80-7

    Suzhou Howsine Biological Technology Co., Ltd was founded in 2007. It is a high-tech enterprise based on the research, customer oriented , specialized in R&D,manufacturing, selling

  •  Suzhou Howsine Biological Technology Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-512-67262751

    Address:No 3,Weihua Road ,Suzhou Industrial Park ,Jiangsu ,China.

       Inquiry Now

  • CRF (HUMAN, RAT),86784-80-7

  • Casno:

    86784-80-7

    CRF (HUMAN, RAT),86784-80-7

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    instock with good quality and wholesale price Storage:Keep in a cool & dry place Package:Packing material and QTY as your request Application:Pharma;Industry;other application Transportation:Express or as your request Port:Any port of China

    Wuhan MoonZY Biological Technology Co.,Ltd (MoonzyBio)is located in Wuhan city,hubei province,China,we have a group of senior technical backbones, specialized in R & D and sales in

  •  Wuhan MoonZY Biological Technology Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:13545198479

    Address:203,Building 3, International Enterprise Center, No. 1 Guanshan 2nd Road, East Lake New Technology Development Zone,

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    We are committed to providing our customers with the best products and services at the most competitive prices.Appearance:white powder Storage:Room temperature with sealed well Package:according to the clients requirement Application:Use as primary a

    BOC Sciences is a chemistry division of CD Inc that has established its headquarters in New York State, USA. At CD Inc, we provide a full range of CRO services that cover the entir

  •  Boc Sciences

    United States  |  Contact Details

    Business Type:Trading Company

    Tel:1-631-5046093

    Address:45-16 Ramsey Road Shirley, NY 11967, USA

       Inquiry Now

  • CRF (human, rat) acetate

  • Casno:

    86784-80-7

    CRF (human, rat) acetate

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    86784-80-7 Application:intermediate

    SAGECHEM is a chemical R&D, manufacturing and distribution company since 2009, including pharmaceutical intermediates, agrochemical, dyestuff intermediates, organosilicone, API and

  •  SAGECHEM LIMITED

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-86818502

    Address:5Fl. 501Room, Tower A, New Youth Plaza, 8 Jia Shan Road, Hangzhou, China

       Inquiry Now

  • Corticotropin Releasing Factor human, rat manufacturer

  • Casno:

    86784-80-7

    Corticotropin Releasing Factor human, rat manufacturer

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Known for its best quality and competitve price, this chemicals we offered is widely appreciated by our customers.Appearance:White powder Storage:keep sealed and keep from direct light Package:According client's requirements Application:pharmaceutica

    Shanghai Yuanye Bio-Technology Co., Ltd. is a comprehensive enterprise of life science, specializing in the research, development and sales of biochemical reagents, analytical stan

  •  Shanghai Yuanye Bio-Technology Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-21-67811725

    Address:Building 6, No. 465, Changta Road,Songjiang District,Shanghai,China

       Inquiry Now

  • CRF (human and rat)

  • Casno:

    86784-80-7

    CRF (human and rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Best Seller, High Quality, Competitive Price, Fast Delivery, Quick ResponseAppearance:powder, or liquid Storage:Stored in room temperature, ventilated place Package:Bottle, barrel, cargo, container, etc. Application:Pharmaceuticals, intermediates, AP

  •  LEAP CHEM Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0571-87317139

    Address:hangzhou

       Inquiry Now

  • 86784-80-7

  • Casno:

    86784-80-7

    86784-80-7

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Supply top quality products with a reasonable price Application:api

    Hebei Zhuangkai Biotechnology Co.,Ltd.mainly produces pharmaceutical raw materials, pharmaceutical intermediates and refined products.Our company is one of the important export en

  •  Hebei Zhuangkai Biotechnology Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86

    Address:hebei

       Inquiry Now

  • manufacture CRF (human, rat) Acetate

  • Casno:

    86784-80-7

    MSDS/COA Download

    manufacture CRF (human, rat) Acetate

    Min.Order: 10 Gram

    FOB Price:  USD $ 10.0-20.0/Gram

    Superiority 1.As a professional production leading factory & lab in China in pharmaceutical area of 15 years, our market to USA, Australia, Middle East, Germany, Spain, UK, and so on other country. What’s more, good feedback from our cu

    Filter Biotechnology Co., Ltd is a High-Tech Bio-Chemical Enterprise which is integrated by Professional Scientific R&D, Mass production and Sales. As a world-leading Provider

  • Zhengzhou Filter Biotechnology Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0086-18503829707

    Address:South of Nongye Rd. Zhengdong New District,Zhengzhou

       Inquiry Now

  • Pharmaceutical raw material CRF (human,rat)

  • Casno:

    86784-80-7

    Pharmaceutical raw material CRF (human,rat)

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0/Gram

    Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing th

    Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. We are dedicating to be the most professional, efficient,and reliable partner fo

  • Chengdu Youngshe Chemical Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-28-62328193

    Address:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China

       Inquiry Now

Please post your buying leads,so that our qualified suppliers will soon contact you!
*Required Fields

Chemistry

Chemical Name: CRF (HUMAN, RAT)
CAS No.: 86784-80-7
RTECS: GM7925000
Molecular Formula: C208H344N60O63S2
Molecular Weight: 4757.45 g/mol
Storage temp.: -20°C
Product Categories about Human corticotropin-releasing factor (CAS No.:86784-80-7) are Peptide ; CRF receptor and related
The chemical synonymous of Human corticotropin-releasing factor (CAS No.:86784-80-7) are SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2 ; SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 ; Corticotropin releasing factor ; Corticotropin releasing factor (CRF), human, rat ; Corticotropin releasing factor, human ; Corticotropin releasing factor, human and rat ; Corticotropin releasing factor human, rat ; CRF, human and rat

Toxicity Data With Reference

1.    

ivn-rat LD50:>1 mg/kg

    YACHDS    Yakuri to Chiryo. Pharmacology and Therapeutics. 20 (Suppl 5),(1992),S1241.
2.    

ivn-dog LD50:>1 mg/kg

    YACHDS    Yakuri to Chiryo. Pharmacology and Therapeutics. 20 (Suppl 5),(1992),S1241.

Safety Profile

Moderately toxic by intravenous route. Experimental reproductive effects. When heated to decomposition it emits toxic vapors of NOx and SOx.