The sodium influx stimulating peptide of the pulmonate freshwater snail Lymnaea stagnalis
-
Add time:08/10/2019 Source:sciencedirect.com
In Lymnaea stagnalis integumental Na+ uptake is stimulated by the sodium influx stimulating (SIS)-peptide. Its primary structure was determined as: SRTQSRFASYELMGTEGTECVTTKTISQICYQCATRHEDSFVQVYQECCKKEMGLREYCEEIYTELPIRSGLWQPN. Antisera raised against parts of SIS-peptide stained neurons in the visceral, parietal, and pleural ganglia, and in the proximal parts of the intestinal, anal, and right internal pallial nerves. Locations and axon projection patterns of these neurons suggest that they represent the previously described neurosecretory yellow cells.
We also recommend Trading Suppliers and Manufacturers of sodium-influx-stimulating peptide (cas 135231-13-9). Pls Click Website Link as below: cas 135231-13-9 suppliers
Prev:Biochemical evidence of the sodium influx stimulating related peptide in the brain of the leech Theromyzon tessulatum
Next:Role of peptide transporter 2 and MAPK signaling pathways in the innate immune response induced by bacterial peptides in alveolar epithelial cells) - 【Back】【Close 】【Print】【Add to favorite 】
- Related Information
- Some polypeptides in the nervous system of the marine worm, Nereis diversicolor, are related to the sodium influx stimulating peptide of the pulmonate freshwater snail, Lymnaea stagnalis08/13/2019
- High affinity CXCR4 inhibitors generated by linking low affinity peptides08/12/2019
- Role of peptide transporter 2 and MAPK signaling pathways in the innate immune response induced by bacterial peptides in alveolar epithelial cells08/11/2019
- Biochemical evidence of the sodium influx stimulating related peptide in the brain of the leech Theromyzon tessulatum08/09/2019
