Welcome to LookChem.com Sign In | Join Free

Science Details

Home > Chemical Encyclopedia > Science List > Details
  • Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris

  • Add time:07/24/2019    Source:sciencedirect.com

    The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, ResourceTM S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.

    We also recommend Trading Suppliers and Manufacturers of neuropeptide Y (20-36) (cas 112602-67-2). Pls Click Website Link as below: cas 112602-67-2 suppliers

    Prev:Neuropeptide Y is Up-regulated and Induces Antinociception in Cancer-induced Bone Pain
    Next:5′-deoxy-5′-difluoromethylthioadenosine, a potent enzyme-activated acylating agent of S-adenosyl-L-homocysteine hydrolase)

  • Back】【Close 】【Print】【Add to favorite
Periodic Table
    Related Products