2675-89-0

Basic information

• Product Name: 2-Chloro-N,N-dimethylacetamide
• Synonyms: N,N-DIMETHYL-2-CHLOROACETAMIDE;N,N-DIMETHYLCHLOROACETAMIDE;N,N-DIMETHYLCHOROACETAMIDE;CHLOROACETYLDIMETHYLAMINE;AKOS BBS-00000943;2-CHLORO-N,N-DIMETHYLACETAMIDE;2-Chloro-N,N-Dimethyl Butylamine;2-CHLORO-N,N-DIMETHYL ACETAMINE
• CAS NO: 2675-89-0
• Molecular Formula: C₄H₈ClNO
• Molecular Weight: 121.57
• EINECS: 220-224-4
• Mol File: 2675-89-0.mol
• Article Data: 31

Chemical Properties

• Melting Point: 15-16 °C
• Boiling Point: 98-100°C/11mm
• Flash Point: 98-100°C/11mm
• Appearance: Clear colorless to pale yellow/Liquid
• Density: 1.182 g/mL at 20 °C(lit.)
• Vapor Pressure: 1.28mmHg at 25°C
• Refractive Index: n20/D 1.479
• Storage Temp.: Store below +30°C.
• Solubility: Chloroform (Slightly), Hexane (Slightly), Methanol (Slightly)
• PKA: -0.95±0.70(Predicted)
• BRN: 969568
• CAS DataBase Reference: 2-Chloro-N,N-dimethylacetamide(CAS DataBase Reference)
• NIST Chemistry Reference: 2-Chloro-N,N-dimethylacetamide(2675-89-0)
• EPA Substance Registry System: 2-Chloro-N,N-dimethylacetamide(2675-89-0)

Safety Data

• Hazard Codes: C
• Statements: 22-34
• Safety Statements: 26-36/37/39-45
• RIDADR: UN 3265 8/PG 3
• WGK Germany: 3
• Hazardous Substances Data: 2675-89-0(Hazardous Substances Data)

Usage

Uses

Different sources of media describe the Uses of 2675-89-0 differently. You can refer to the following data:
1. 2-Chloro-N,N-dimethylacetamide is N,M-dialkyl amide used as an organic catalyst in the preparation of phosphorylated thiosemicarbazide.
2. 2-Chloro-N,N-dimethylacetamide (N,N-dimethylchloroacetamide) was used in the synthesis of (S)-carbinoxamine.

InChI:InChI=1/C4H8ClNO/c1-6(2)4(7)3-5/h3H2,1-2H3

Synthetic route

dimethyl amine (124-40-3) + chloroacetyl chloride (79-04-9) → 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
With sodium hydrogencarbonate In toluene at -2 - 5℃; for 1h; Reagent/catalyst; Solvent; Temperature;	93.1%
With triethylamine In dichloromethane at -5 - 20℃; for 13h; Inert atmosphere;	93.09%
In diethyl ether at 20℃; Cooling;	81%

N,N-dimethylammonium chloride (506-59-2) + chloroacetyl chloride (79-04-9) → 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
With triethylamine In dichloromethane at 15℃;	77%
With triethylamine In dichloromethane at 0℃; for 3h;	62%
With sodium hydroxide In 1,2-dichloro-ethane at -5℃; for 0.5h;	33%

diethyl 2-amino-6-[(hydroxycarbamoyl)-methyl]-azulene-1,3-dicarboxylate sodium (227945-00-8) → diethyl 2-amino-6-[(2-oxo-2-N,N-dimethylamino-ethoxycarbamoyl)-methyl]-azulene-1,3-dicarboxylate + 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
	A 27% B n/a

Ketene (463-51-4) + diethyl ether (60-29-7) + dimethylchloroamine (1585-74-6) → 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
at -60℃;

Ketene (463-51-4) + dimethylchloroamine (1585-74-6) → 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
With diethyl ether at -60℃;

Chloroacetic anhydride (541-88-8) + N,N-Dimethylcarbamoyl chloride (79-44-7) → 2-chloro-N,N-dimethylacetamide (2675-89-0)

sodium monochloroacetic acid (3926-62-3) + N,N-Dimethylcarbamoyl chloride (79-44-7) → 2-chloro-N,N-dimethylacetamide (2675-89-0)

bis-(dimethylamino)methane (51-80-9) + Chloroacetic anhydride (541-88-8) → 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
In chloroform

Dimethyl-(6-methyl-2-oxo-2λ5-[1,3,2]oxathiaphosphinan-2-yl)-amine (139575-17-0) → 2-Chloro-6-methyl-[1,3,2]oxathiaphosphinane 2-oxide (139575-18-1) + 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
With chloroacetyl chloride Heating;

Dimethyl-(6-methyl-2-oxo-2λ5-[1,3,2]oxathiaphosphinan-2-yl)-amine (139575-17-0) + chloroacetyl chloride (79-04-9) → 2-Chloro-6-methyl-[1,3,2]oxathiaphosphinane 2-oxide (139575-18-1) + 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
Heating;

dimethyl amine (124-40-3) + chloroacetic acid (79-11-8) → 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
Stage #1: chloroacetic acid With dicyclohexyl-carbodiimide In dichloromethane at 20℃; for 0.5h; Stage #2: dimethyl amine With dmap In dichloromethane at 20℃;

chloroacetyl chloride (79-04-9) + methylamine (74-89-5) → 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
In tetrahydrofuran; dichloromethane at -40℃; for 1h;

N,N-dimethyl acetamide (127-19-5) → 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
With copper dichloride at 150℃; for 24h; Inert atmosphere;

N,N-dimethyl acetamide (127-19-5) → 4-chloro-N,N-dimethyl-3-oxobutanamide + 2-chloro-N,N-dimethylacetamide (2675-89-0)

Conditions	Yield
Stage #1: N,N-dimethyl acetamide With n-butyllithium; diisopropylamine In tetrahydrofuran; hexane at -78℃; for 0.5h; Inert atmosphere; Stage #2: With methyl chlorosulfate In tetrahydrofuran; hexane at -78℃; for 0.5h; Inert atmosphere; Overall yield = 99 %; Overall yield = 87 mg;

1-benzyloxy-5-(4-methoxy-benzyloxy)-9-(tetrahydro-pyran-2-yloxy)-non-7-en-4-ol (934977-35-2) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → 2-[1-(3-benzyloxy-propyl)-2-(4-methoxy-benzyloxy)-6-(tetrahydro-pyran-2-yloxy)-hex-4-enyloxy]-N,N-dimethyl-acetamide (934977-36-3)

Conditions	Yield
Stage #1: 1-benzyloxy-5-(4-methoxy-benzyloxy)-9-(tetrahydro-pyran-2-yloxy)-non-7-en-4-ol With sodium hydride In tetrahydrofuran at 0℃; for 0.166667h; Stage #2: 2-chloro-N,N-dimethylacetamide In tetrahydrofuran at 20℃; for 4h;	100%

1,3-dihydro-1-(1-tert-butyloxycarbonylpiperidin-4-yl)-2H-benzimidazol-2-one (87120-81-8) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → 4-(3-dimethylcarbamoylmethyl-2-oxo-2,3-dihydro-benzimidazol-1-yl)-piperidine-1-carboxylic acid tert-butyl ester (928632-88-6)

Conditions	Yield
With sodium hydride In N,N-dimethyl-formamide	100%

(4S)-3-oxo-8-[2-(8-tert-butoxycarbonyl-5,6,7,8-tetrahydroimidazo[1,2-a]-pyrimidin-2-yl)ethoxy]-2-(2,2,2-trifluoroethyl)-2,3,4,5-tetrahydro-1H-2-benzazepin-4-acetic acid (1152636-93-5) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → (N,N-dimethylaminocarbonyl)methyl (4S)-3-oxo-8-[2-(8-tert-butoxycarbonyt-5,6,7,8-tetrahydroimidazo[1,2-a]pyrimidin-2-yl)ethoxy]-2-(2,2,2-trifluooroethyl)-2,3,4,5-tetrahydro-1H-2-benzazep in-4-acetate (1152636-97-9)

Conditions	Yield
With potassium carbonate In water; N,N-dimethyl-formamide at 20℃; Inert atmosphere;	100%
With potassium carbonate In N,N-dimethyl-formamide at 20℃; for 8h; Inert atmosphere;

(6-{(pyridin-2-ylsulfonyl)[4-(thiazol-2-yl)benzyl]aminomethyl}pyridin-2-ylamino)-acetic acid (1187450-51-6) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → [2-(dimethylamino)-2-oxoethyl] (6-{(pyridin-2-ylsulfonyl)[4-(thiazol-2-yl)benzyl]-aminomethyl} pyridin-2-ylamino)acetate (1273387-10-2)

Conditions	Yield
With potassium carbonate In N,N-dimethyl-formamide at 20℃; for 4h;	100%

methyl 6-(2,6-difluoro-4-hydroxyphenyl)-5-fluoropyridine-2-carboxylate (1355011-30-1) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → methyl 6-(4-(2-(dimethylamino)-2-oxoethoxy)-2,6-difluorophenyl)-5-fluoropicolinate (1395986-73-8)

Conditions	Yield
Stage #1: methyl 6-(2,6-difluoro-4-hydroxyphenyl)-5-fluoropyridine-2-carboxylate With sodium hydride In N,N-dimethyl-formamide; mineral oil at 20℃; for 0.5h; Stage #2: 2-chloro-N,N-dimethylacetamide In N,N-dimethyl-formamide; mineral oil at 20℃;	100%

C17H24O5 (947619-71-8) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C21H31NO6 (947619-72-9)

Conditions	Yield
With sodium hydride In tetrahydrofuran at 20℃; for 0.5h;	99%

3-[(R)-1-(4-bromo-phenyl)-1-cyclopropyl-ethyl]-5-(1H-pyrazol-4-yl)-[1,2,4]oxadiazole (1360552-35-7) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → 2-(4-{3-[(R)-1-(4-bromophenyl)-1-cyclopropylethyl]-[1,2,4]oxadiazol-5-yl}pyrazol-1-yl)-N,N-dimethylacetamide (1360552-37-9)

Conditions	Yield
With potassium carbonate In N,N-dimethyl-formamide at 20℃; Inert atmosphere;	99%

tert-butyl (E)-(2S,3S)-2-[2-(tert-butyl-dimethyl-silanyloxy)-ethyl]-3-[(S)-2-(4-but-2-ynyloxy-phenyl)-1-carboxy-ethylcarbamoyl]-11-(2-heptyl-[1,3]dioxolan-2-yl)-2-hydroxy-undec-4-enoate + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C51H84N2O11Si

Conditions	Yield
With tetra-(n-butyl)ammonium iodide; N-ethyl-N,N-diisopropylamine In dichloromethane at 50℃; for 12h; Inert atmosphere;	99%

(2S,3S)-(+)-1,2-epoxy-3-octanol (96856-99-4) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C12H23NO3

Conditions	Yield
Stage #1: (2S,3S)-(+)-1,2-epoxy-3-octanol With sodium hydride In tetrahydrofuran; mineral oil at 0℃; for 0.166667h; Inert atmosphere; Stage #2: 2-chloro-N,N-dimethylacetamide In tetrahydrofuran; mineral oil at 0 - 20℃; for 7h; Inert atmosphere;	98%

C21H26N2O2 + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C25H33N3O3

Conditions	Yield
Stage #1: C21H26N2O2 With sodium hydride In N,N-dimethyl-formamide; mineral oil at 0 - 20℃; for 0.25h; Stage #2: 2-chloro-N,N-dimethylacetamide In N,N-dimethyl-formamide; mineral oil for 1h;	98%

2-phenyl-6H-pyrrolo<3,2-e>benzoxazole (169170-98-3) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → 8-chloroacetyl-2-phenyl-6H-pyrrolo<3,2-e>benzoxazole

Conditions	Yield
With trichlorophosphate In 1,4-dioxane at 80℃; for 1h;	97%

(S)-(4-Methylphenyl)phenylmethanol (24218-12-0) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → N,N-dimethyl-2-((S)-(4-methylphenyl)(phenyl)methoxy)acetamide

Conditions	Yield
With sodium hydride In tetrahydrofuran at 25℃; for 4h; enantioselective reaction;	97%
With sodium hydride In tetrahydrofuran at 0 - 20℃; for 5h;	91%
With sodium hydride In diethyl ether

(R)-1-(4-Methoxy-benzyloxy)-but-3-en-2-ol + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C16H23NO4 (1214736-95-4)

Conditions	Yield
With sodium hydride In N,N-dimethyl-formamide; mineral oil at 0 - 20℃; Inert atmosphere;	97%

C25H31N3O3 + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C29H38N4O4

Conditions	Yield
With potassium carbonate; sodium iodide In N,N-dimethyl-formamide at 40℃; for 4h;	97%

isopropenylbenzene (98-83-9) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C13H18(2)HNO

Conditions

Yield

With (1-2H)-D-glucose; nicotinamide adenine dinucleotide phosphate; GDH-105 lysate; MPTLFDPIDFGPIHAKNRIVMSPLTRGRADKEAVPAPIMAEYYAQRASAGLIITEATGISREGLGWPFAPGIWSDAQVEAWKPIVAGVHAKGGKIVCQLWHMGRMVHSSVTGTQPVSSSATTAPGEVHTYEGKKPFEQARAIDAADISRILNDYENAARNAIRAGFDGVQIHAANGYLIDEFLRNGTNHRTDEYGGVPENRIRFLKEVTERVIAAIGADRTGVRLSPNGDTQGCIDSAPETVFVPAAKLLQDLGVAWLELREPGPNGTFGKTDQPKLSPQIRKVFLRPLVLNQDYTFEAAQTALAEGKADAIAFGRKFISNPDLPERFARGIALQPDDMKTWYSQGPEGYTDYPSATSGPNN In dimethyl sulfoxide for 24h; pH=9; Reagent/catalyst; Irradiation; Sealed tube; Enzymatic reaction; enantioselective reaction;

97%

2-methyl-(S)-benzhydrol (1517-59-5) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → N,N-dimethyl-2-(phenyl-o-tolyl-methoxy)-acetamide

Conditions	Yield
With sodium hydride In tetrahydrofuran at 20℃;	96.1%
With sodium hydride In tetrahydrofuran at 25℃; for 4h; Substitution;	89%

1'-[(5-chloro-1H-indol-2-yl)carbonyl]-5-fluoro-3H-spiro[2-benzofuran-1,4'-piperidin]-3-one (1032189-20-0) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → 2-{5-chloro-2-[(5-fluoro-3-oxo-1'H,3H-spiro[2-benzofuran-1,4'-piperidin]-1'-yl)carbonyl]-1H-indol-1-yl}-N,N-dimethylacetamide (1032189-22-2)

Conditions	Yield
Stage #1: 1'-[(5-chloro-1H-indol-2-yl)carbonyl]-5-fluoro-3H-spiro[2-benzofuran-1,4'-piperidin]-3-one With sodium hydride In N,N-dimethyl-formamide; mineral oil at 20℃; for 0.333333h; Stage #2: 2-chloro-N,N-dimethylacetamide In N,N-dimethyl-formamide; mineral oil at 20℃;	96%

C28H38O5 (1214737-09-3) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C32H45NO6 (1214737-10-6)

Conditions	Yield
With sodium hydride In N,N-dimethyl-formamide; mineral oil at 0 - 20℃; for 3h; Inert atmosphere;	96%

C22H28O4 (1309589-62-5) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C26H35NO5 (1309589-63-6)

Conditions	Yield
With sodium hydride In tetrahydrofuran; N,N-dimethyl-formamide at 0 - 20℃; for 15h; Williamson etherification;	96%

5-(4-{(R)-1-cyclopropyl-1-[5-(1H-pyrazol-4-yl)-[1,2,4]oxadiazol-3-yl]ethyl}phenyl)pyrimidin-2-ylamine (1360549-37-6) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → 2-[4-(3-{(1R)-1-[4-(2-aminopyrimidin-5-yl)phenyl]-1-cyclopropylethyl}-1,2,4-oxadiazol-5-yl)-1H-pyrazol-1-yl]-N,N-dimethylacetamide (1360550-04-4)

Conditions	Yield
With 1,8-diazabicyclo[5.4.0]undec-7-ene In N,N-dimethyl-formamide at 48 - 50℃; for 0.5h; Large scale;	95.6%
With 1,8-diazabicyclo[5.4.0]undec-7-ene In N,N-dimethyl-formamide at 50℃; for 1h; Inert atmosphere;	94.4%
With potassium carbonate In N,N-dimethyl-formamide at 20℃; for 2h;
With potassium carbonate In N,N-dimethyl-formamide at 20℃; for 2h;	10 g

25,26-Bis<(ethoxycarbonyl)methoxy>-27,28-dihydroxycalix<4>arene (147087-50-1) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → 25,26-Bis<(dimethylcarbamoyl)methoxy>-27,28-bis<(ethoxycarbonyl)methoxy>calix<4>arene

Conditions	Yield
With caesium carbonate; sodium iodide In acetonitrile at 60℃;	95%

(4R,5R)-7-benzyloxy-5-(4-methoxybenzyloxy)hept-1-en-4-ol (869386-01-6) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → (1'R,1R)-2-{1-[3'-benzyloxy-1'-(4-methoxybenzyloxy)propyl]but-3-enyloxy}-N,N-dimethylacetamide (869385-99-9)

Conditions	Yield
With sodium hydride In tetrahydrofuran at 20℃; for 3h;	95%

(1,4,8,11-tetraazacyclotetradec-1-yl)acetic acid ethyl ester (468743-82-0) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C26H51N7O5 (1186313-12-1)

Conditions	Yield
With potassium carbonate In acetonitrile at 30 - 45℃; for 48h;	95%

2-chloro-9-cyclohexyl-7,9-dihydro-8H-purin-8-one (1352623-69-8) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → 2-(2-chloro-9-cyclohexyl-8-oxo-8,9-dihydro-7H-purin-7-yl)-N,N-dimethyl acetamide (1415152-41-8)

Conditions	Yield
Stage #1: 2-chloro-9-cyclohexyl-7,9-dihydro-8H-purin-8-one; 2-chloro-N,N-dimethylacetamide With sodium hydride In N,N-dimethyl-formamide; mineral oil for 3.25h; Cooling with ice; Stage #2: for 3h;	95%

1-(benzyloxymethyl)-4-(cyanomethyl)-2-methyl-5-nitroindole (1417791-63-9) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → 3-(1-benzyloxymethyl-2-methyl-5-nitro-1H-indol-4-yl)-3-cyano-N,N-dimethylpropionamide

Conditions	Yield
With 1,8-diazabicyclo[5.4.0]undec-7-ene In N,N-dimethyl-formamide at 60℃; for 24h;	95%

C18H12O4 + 2-chloro-N,N-dimethylacetamide (2675-89-0) → (E)-N,N-dimethyl-2-(3-(3-oxo-3-(2-oxo-2H-chromen-3-yl)prop-1-en-1-yl)phenoxy)acetamide

Conditions	Yield
With potassium carbonate; sodium iodide In N,N-dimethyl-formamide at 56℃;	94.6%

ephedrine (299-42-3) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → (1R,2S)-2-<(β-hydroxy-α-methylphenethyl)methylamino>-N,N-dimethylacetamide (130753-27-4)

Conditions	Yield
With triethylamine In benzene for 8h; Heating;	94%

(1R,2R)-pseudoephedrine (321-97-1) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → (1R,2R)-2-<(β-hydroxy-α-methylphenethyl)methylamino>-N,N-dimethylacetamide (139528-26-0)

Conditions	Yield
With triethylamine In benzene for 8h; Heating;	94%

n-Pent-4-enyl alcohol (821-09-0) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → N,N-dimethyl-2-(pent-4-enyloxy)acetamide (1293379-62-0)

Conditions	Yield
Stage #1: n-Pent-4-enyl alcohol With sodium hydride In tetrahydrofuran; mineral oil at 0℃; Williamson ether synthesis; Stage #2: 2-chloro-N,N-dimethylacetamide In tetrahydrofuran; mineral oil at 0 - 20℃; Williamson ether synthesis;	94%
Stage #1: n-Pent-4-enyl alcohol With sodium hydride In tetrahydrofuran; mineral oil at 0℃; for 1h; Williamson synthesis; Inert atmosphere; Stage #2: 2-chloro-N,N-dimethylacetamide In tetrahydrofuran; mineral oil at 20℃; for 24h; Inert atmosphere;	94%

4,4'-bis[5-heptafluoropropyl-4-(4-pyridyl)oxazol-2-yl]biphenyl (1346142-23-1) + 2-chloro-N,N-dimethylacetamide (2675-89-0) → C42H32F14N6O4(2+)*2Cl(1-)

Conditions	Yield
at 110℃; for 48h; Inert atmosphere;	94%

Upstream product

• 463-51-4 Ketene 
• 60-29-7 diethyl ether 
• 1585-74-6 dimethylchloroamine 
• 124-40-3 dimethyl amine 
• 79-04-9 chloroacetyl chloride 
• 541-88-8 Chloroacetic anhydride 
• 79-44-7 N,N-Dimethylcarbamoyl chloride 
• 3926-62-3 sodium monochloroacetic acid 
• 79-11-8 chloroacetic acid 
• 127-19-5 N,N-dimethyl acetamide 
• 227945-00-8 diethyl 2-amino-6-[(hydroxycarbamoyl)-methyl]-azulene-1,3-dicarboxylate sodium 
• 74-89-5 methylamine 
• 139575-17-0 Dimethyl-(6-methyl-2-oxo-2λ⁵-[1,3,2]oxathiaphosphinan-2-yl)-amine 
• 506-59-2 N,N-dimethylammonium chloride 

Downstream Products

• 28755-03-5 3-chloroacetylindole 
• 103097-20-7 N-(1-methyl-4-phenyl-[4]piperidylmethyl)-glycine-dimethylamide 
• 14307-89-2 2-anilino-N,N-dimethylacetamide 
• 64754-82-1 3-methyl-3-phenyl-oxiranecarboxylic acid dimethylamide 
• 108245-07-4 N-(2,4-dimethyl-phenyl)-glycine dimethylamide 
• 91429-74-2 N,N-dimethyl-2-(methyl(phenyl)amino)acetamide 
• 100316-68-5 N-(2-ethyl-phenyl)-glycine dimethylamide 
• 108245-08-5 N-(2,5-dimethyl-phenyl)-glycine dimethylamide 
• 2279-84-7 dithiophosphoric acid O,O'-diethyl ester-S-(dimethylcarbamoyl-methyl ester) 
• 23694-02-2 2-chloro-1-(1-methyl-1H-pyrrol-2-yl)ethanone 
• 126624-55-3 1-Methyl-3-chloroacetylpyrrole 
• 23693-98-3 1-Phenyl-2-chloroacetylpyrrole 
• 126624-58-6 1-Phenyl-3-chloroacetylpyrrole 
• 23693-97-2 1-(1-benzyl-1H-pyrrol-2-yl)-2-chloroethanone 

Relevant articles and documents

Studies in sulfur-nitrogen nucleophilicity

As part of a study of nitrogen vs sulfur nucleophiles, the behavior of methylation products from dimethyl-(2-methylthioethyl)amine CH3SCH2CH2N(CH3)2 1 is described. Of the 2 potential products (a sulf

Design, synthesis, and biological evaluation of 2,6,7-substituted pyrrolo[2,3-d]pyrimidines as cyclin dependent kinase inhibitor in pancreatic cancer cells

Pancreatic cancer is a highly malignant tumor, and more effective treatment is urgently needed to lengthen the life of patients. In this paper a class of new 2,6,7-substituted pyrrolo[2,3-d]pyrimidine derivatives of CDK 4/6 inhibitor ribociclib (1) was de

Novel selective ido1 inhibitors with isoxazolo[5,4-d]pyrimidin-4(5h)-one scaffold

Indoleamine 2,3-dioxygenase 1 (IDO1) is a promising target in immunomodulation of several pathological conditions, especially cancers. Here we present the synthesis of a series of IDO1 inhibitors with the novel isoxazolo[5,4-d]pyrimidin-4(5H)-one scaffold. A focused library was prepared using a 6-or 7-step synthetic procedure to allow a systematic investigation of the structure-activity relationships of the described scaffold. Chemistry-driven modifications lead us to the discovery of our best-in-class inhibitors possessing p-trifluoromethyl (23), p-cyclohexyl (32), or p-methoxycarbonyl (20, 39) substituted aniline moieties with IC50 values in the low micromolar range. In addition to hIDO1, compounds were tested for their inhibition of indoleamine 2,3-dioxygenase 2 and tryptophan dioxygenase, and found to be selective for hIDO1. Our results thus demon-strate a successful study on IDO1-selective isoxazolo[5,4-d]pyrimidin-4(5H)-one inhibitors, defining promising chemical probes with a novel scaffold for further development of potent small-molecule immunomodulators.

Design, synthesis and evaluation of new indolylpyrimidylpiperazines for gastrointestinal cancer therapy

Human A3 adenosine receptor hA3AR has been implicated in gastrointestinal cancer, where its cellular expression has been found increased, thus suggesting its potential as a molecular target for novel anticancer compounds. Observation